AGI ID: At2g46870

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: RAV-like B3 domain DNA binding protein

Amino Acid Sequence:


1
61
121
181
241
301
>At2g46870
MMTDLSLTRD EDEEEAKPLA EEEGAREVAD REHMFDKVVT PSDVGKLNRL VIPKQHAERF
FPLDSSSNEK GLLLNFEDLT GKSWRFRYSY WNSSQSYVMT KGWSRFVKDK KLDAGDIVSF
QRCVGDSGRD SRLFIDWRRR PKVPDHPHFA AGAMFPRFYS FPSTNYSLYN HQQQRHHHSG
GGYNYHQIPR EFGYGYFVRS VDQRNNPAAA VADPLVIESV PVMMHGRANQ ELVGTAGKRL
RLFGVDMECG ESGMTNSTEE ESSSSGGSLP RGGGGGASSS SFFQLRLGSS SEDDHFTKKG
KSSLSFDLDQ
Length = 310 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At2g46870

>At2g46870 RAV-like B3 domain DNA binding protein
          Length = 310

 Score =  184 bits (467), Expect = 2e-46
 Identities = 43/136 (31%), Positives = 62/136 (44%), Gaps = 6/136 (4%)

Query: 128 MSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPL 187
           +SL     E +  P+ +    R        F K +T SD        +P++ AE+ FP L
Sbjct: 5   LSLTRDEDEEEAKPLAEEEGAREVADREHMFDKVVTPSDVGKLNRLVIPKQHAERFFP-L 63

Query: 188 DYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLFIR- 246
           D S+      L   DL   +W FR+ Y    + +++T GWS FV  K+L AGD V F R 
Sbjct: 64  DSSSNEKGLLLNFEDLTGKSWRFRYSYWNSSQSYVMTKGWSRFVKDKKLDAGDIVSFQRC 123

Query: 247 ----DEKSQLMVGVRR 258
                  S+L +  RR
Sbjct: 124 VGDSGRDSRLFIDWRR 139


InterPro Results:

IPR003340 Family
PF02362 T[34-143] 1.1e-19 B3
Transcriptional factor B3
NULL
seg ?[11-25]?[171-182]?[250-281] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5184 2e-46
TF_17_3 ARFETTIN/ARF3168 9e-42
TF_17_2 ARFNPH4/ARF7160 4e-39
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3134 2e-31
TF_22_1 ABI3/VP1FUSCA3123 9e-29

TOP