AGI ID: At2g46830

TF ID:TF_1_6
Super family:MYB superfamily
Sub family:CIRCADIAN CLOCK ASSOCIATED 1
Gene name: CCA1

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At2g46830
METNSSGEDL VIKTRKPYTI TKQRERWTEE EHNRFIEALR LYGRAWQKIE EHVATKTAVQ
IRSHAQKFFS KVEKEAEAKG VAMGQALDIA IPPPRPKRKP NNPYPRKTGS GTILMSKTGV
NDGKESLGSE KVSHPEMANE DRQQSKPEEK TLQEDNCSDC FTHQYLSAAS SMNKSCIETS
NASTFREFLP SREEGSQNNR VRKESNSDLN AKSLENGNEQ GPQTYPMHIP VLVPLGSSIT
SSLSHPPSEP DSHPHTVAGD YQSFPNHIMS TLLQTPALYT AATFASSFWP PDSSGGSPVP
GNSPPNLAAM AAATVAAASA WWAANGLLPL CAPLSSGGFT SHPPSTFGPS CDVEYTKAST
LQHGSVQSRE QEHSEASKAR SSLDSEDVEN KSKPVCHEQP SATPESDAKG SDGAGDRKQV
DRSSCGSNTP SSSDDVEADA SERQEDGTNG EVKETNEDTN KPQTSESNAR RSRISSNITD
PWKSVSDEGR IAFQALFSRE VLPQSFTYRE EHREEEQQQQ EQRYPMALDL NFTAQLTPVD
DQEEKRNTGF LGIGLDASKL MSRGRTGFKP YKRCSMEAKE SRILNNNPII HVEQKDPKRM
RLETQAST
Length = 608 AA.

PSI BLAST Result:

Query: Query sequence of TF_1_6
Sbjct: At2g46830

>At2g46830 CCA1
          Length = 608

 Score =  781 bits (2016), Expect = 0.0
 Identities = 496/608 (81%), Positives = 496/608 (81%)

Query: 1   METNSSGEDLVIKTRKPYTITKQRERWTEEEHNRFIEALRLYGRAWQKIEEHVATKTAVQ 60
           METNSSGEDLVIKTRKPYTITKQRERWTEEEHNRFIEALRLYGRAWQKIEEHVATKTAVQ
Sbjct: 1   METNSSGEDLVIKTRKPYTITKQRERWTEEEHNRFIEALRLYGRAWQKIEEHVATKTAVQ 60

Query: 61  IRSHAQKFFSKVEKEAEAKGVAMGQALDIAIXXXXXXXXXXXXXXXXTGSGTILMSKTGV 120
           IRSHAQKFFSKVEKEAEAKGVAMGQALDIAI                TGSGTILMSKTGV
Sbjct: 61  IRSHAQKFFSKVEKEAEAKGVAMGQALDIAIPPPRPKRKPNNPYPRKTGSGTILMSKTGV 120

Query: 121 NDGKESLGSEKVSHPEMANEDRQQSKPEEKTLQEDNCSDCFTHQYLSAASSMNKSCIETS 180
           NDGKESLGSEKVSHPEMANEDRQQSKPEEKTLQEDNCSDCFTHQYLSAASSMNKSCIETS
Sbjct: 121 NDGKESLGSEKVSHPEMANEDRQQSKPEEKTLQEDNCSDCFTHQYLSAASSMNKSCIETS 180

Query: 181 NASTFREFLPSREEGSQNNRVRKESNSDLNAKSLENGNEQGPQTYPMHIPVLVXXXXXXX 240
           NASTFREFLPSREEGSQNNRVRKESNSDLNAKSLENGNEQGPQTYPMHIPVLV       
Sbjct: 181 NASTFREFLPSREEGSQNNRVRKESNSDLNAKSLENGNEQGPQTYPMHIPVLVPLGSSIT 240

Query: 241 XXXXXXXXXXXXXXXTVAGDYQSFPNHIMSTLLQTPALYTAATFASSFWXXXXXXXXXXX 300
                          TVAGDYQSFPNHIMSTLLQTPALYTAATFASSFW           
Sbjct: 241 SSLSHPPSEPDSHPHTVAGDYQSFPNHIMSTLLQTPALYTAATFASSFWPPDSSGGSPVP 300

Query: 301 XXXXXNLXXXXXXXXXXXXXXXXXNGLLPLCAPLSSGGFTSHPPSTFGPSCDVEYTKAST 360
                NL                 NGLLPLCAPLSSGGFTSHPPSTFGPSCDVEYTKAST
Sbjct: 301 GNSPPNLAAMAAATVAAASAWWAANGLLPLCAPLSSGGFTSHPPSTFGPSCDVEYTKAST 360

Query: 361 LQHGSVQSREQEHSEASKARSSLDSEDVENKSKPVCHEQPSATPESDAKGSDGAGDRKQV 420
           LQHGSVQSREQEHSEASKARSSLDSEDVENKSKPVCHEQPSATPESDAKGSDGAGDRKQV
Sbjct: 361 LQHGSVQSREQEHSEASKARSSLDSEDVENKSKPVCHEQPSATPESDAKGSDGAGDRKQV 420

Query: 421 DRSSCGSNTPXXXXXXXXXXXXRQEDGTNGEVKETNEDTNKPQTXXXXXXXXXXXXXXTD 480
           DRSSCGSNTP            RQEDGTNGEVKETNEDTNKPQT              TD
Sbjct: 421 DRSSCGSNTPSSSDDVEADASERQEDGTNGEVKETNEDTNKPQTSESNARRSRISSNITD 480

Query: 481 PWKSVSDEGRIAFQALFSREVLPQSFTYXXXXXXXXXXXXXXXYPMALDLNFTAQLTPVD 540
           PWKSVSDEGRIAFQALFSREVLPQSFTY               YPMALDLNFTAQLTPVD
Sbjct: 481 PWKSVSDEGRIAFQALFSREVLPQSFTYREEHREEEQQQQEQRYPMALDLNFTAQLTPVD 540

Query: 541 DQEEKRNTGFLGIGLDASKLMSRGRTGFKPYKRCSMEAKESRILNNNPIIHVEQKDPKRM 600
           DQEEKRNTGFLGIGLDASKLMSRGRTGFKPYKRCSMEAKESRILNNNPIIHVEQKDPKRM
Sbjct: 541 DQEEKRNTGFLGIGLDASKLMSRGRTGFKPYKRCSMEAKESRILNNNPIIHVEQKDPKRM 600

Query: 601 RLETQAST 608
           RLETQAST
Sbjct: 601 RLETQAST 608


InterPro Results:

IPR001005 Domain
PF00249 T[24-69] 2.1e-13 Myb_DNA-binding
SM00717 T[23-71] 1e-12 SANT
PS50090 T[19-69] 10.752 MYB_3
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[22-72] 2.1e-24 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[18-76] 2.6e-14 Homeodomain-like
Homeodomain-like
NULL
seg ?[92-107]?[234-255]?[290-305]?[308-324]?[431-442]?[465-478]?[509-523] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1781 0.0
TF_1_2 MYB superfamilyLHY664 0.0
TF_1_4 MYB superfamilyATR1 61 8e-10
TF_63 SW13 43 5e-04
TF_10_2 GARPARR-B class 38 9e-04

TOP