AGI ID: At2g46530

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: putative ARF1 family auxin responsive transcription fa...

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At2g46530
MSQTSLEPLI ISIIKLQILQ LWLKLIAVGW NLGSNDDELY TELWKACAGP LVEVPRYGER
VFYFPQGHME QLVASTNQGV VDQEIPVFNL PPKILCRVLS VTLKAEHETD EVYAQITLQP
EEDQSEPTSL DPPLVEPAKP TVDSFVKILT ASDTSTHGGF SVLRKHATEC LPSLDMTQPT
PTQELVARDL HGYEWRFKHI FRGQPRRHLL TTGWSTFVTS KRLVAGDAFV FLRGETGDLR
VGVRRLAKQQ STMPASVISS QSMRLGVLAT ASHAVTTTTI FVVFYKPRIS QFIISVNKYM
MAMKNGFSLG MRYRMRFEGE ESPERIFTGT IIGSGDLSSQ WPASKWRSLQ IQWDEPSSIQ
RPNKVSPWEI EPFSPSALTP TPTQQQSKSK RSRPISEITG SPVASSFLSS FSQSHESNPS
VKLLFQDPAT ERNSNKSVFS SGLQCKITEA PVTSSCRLFG FDLTSKPASA TIPHDKQLIS
VDSNISDSTT KCQDPNSSNS PKEQKQQTST RSRIKVQMQG TAVGRAVDLT LLRSYDELIK
ELEKMFEIEG ELSPKDKWAI VFTDDEGDRM LVGDDPWNEF CKMAKKLFIY PSDEVKKMRS
KSLLGDKGTI VNLESDQRTV HV
Length = 622 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At2g46530

>At2g46530 putative ARF1 family auxin responsive transcription factor
          Length = 622

 Score =  584 bits (1505), Expect = e-167
 Identities = 189/503 (37%), Positives = 283/503 (55%), Gaps = 19/503 (3%)

Query: 45  GTRKPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPS 104
           G+    + +ELW ACAGPLV +P+ G  V+YF QGH EQ+  ST +    Q     NLP 
Sbjct: 33  GSNDDELYTELWKACAGPLVEVPRYGERVFYFPQGHMEQLVASTNQGVVDQEIPVFNLPP 92

Query: 105 QLMCQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTA 164
           +++C+V +VTL A+ ++DE+YAQ++LQP   + +   + D  ++  +K   + F K LTA
Sbjct: 93  KILCRVLSVTLKAEHETDEVYAQITLQPEEDQSEPTSL-DPPLVEPAKPTVDSFVKILTA 151

Query: 165 SDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLT 224
           SDTSTHGGFSV R+ A +  P LD +   PTQELV RDLH   W F+HI+RGQP+RHLLT
Sbjct: 152 SDTSTHGGFSVLRKHATECLPSLDMTQPTPTQELVARDLHGYEWRFKHIFRGQPRRHLLT 211

Query: 225 TGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLXXX 284
           TGWS FV SKRL AGD+ +F+R E   L VGVRR  +QQ+ +P+SV+S+ SM +GVL   
Sbjct: 212 TGWSTFVTSKRLVAGDAFVFLRGETGDLRVGVRRLAKQQSTMPASVISSQSMRLGVLATA 271

Query: 285 XXXXXNRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYM 344
                  T F++FY PR   ++F+I + KY  A+  +  S+GMR+ M FE E+S +R + 
Sbjct: 272 SHAVTTTTIFVVFYKPRI--SQFIISVNKYMMAM-KNGFSLGMRYRMRFEGEESPERIFT 328

Query: 345 GTIVGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLTSGLK 404
           GTI+G  DL   +WP SKWR+LQ++WDEP    +P +VSPW+IE      + P+ T    
Sbjct: 329 GTIIGSGDLSS-QWPASKWRSLQIQWDEPSSIQRPNKVSPWEIEPFSPSALTPTPTQQQS 387

Query: 405 RQLHPSYFAGETEWGSLIKRPLIRVPDSANGIMPYASFPSMASEQLMKMMMRPHNNQNVP 464
           +       +  +   S I    +     ++    + S PS+          R  N     
Sbjct: 388 K-------SKRSRPISEITGSPVASSFLSSFSQSHESNPSVKLLFQDPATERNSNKSVFS 440

Query: 465 SFMS-EMQQNIVMGNGGLLGDMKMQQPLMMNQKSEMVQPQNKLTVNPSASNTSGQEQNLS 523
           S +  ++ +  V  +  L G     +P      + +   +  ++V+ + S+++ + Q+ +
Sbjct: 441 SGLQCKITEAPVTSSCRLFGFDLTSKPA----SATIPHDKQLISVDSNISDSTTKCQDPN 496

Query: 524 QSMSAPAKPENSTLSGCSSGRVQ 546
              S   K +    S  S  +VQ
Sbjct: 497 S--SNSPKEQKQQTSTRSRIKVQ 517



 Score =  162 bits (411), Expect = 7e-40
 Identities = 66/288 (22%), Positives = 113/288 (38%), Gaps = 27/288 (9%)

Query: 631 PFILSSQDSSAVVLPDSTNSPLFHDVWDTQLNGLKFDQFSPLMQQDLYAS---------Q 681
             I+ S D S+        S      WD   +  + ++ SP   +    S         Q
Sbjct: 329 GTIIGSGDLSSQWPASKWRS--LQIQWDEPSSIQRPNKVSPWEIEPFSPSALTPTPTQQQ 386

Query: 682 NICMSNSTTSNILDPPLSNTVLDDFCAIKDT----DFQNHPSGCLVGNNNTSFAQDVQSQ 737
           +    +   S I   P++++ L  F    ++                +N + F+  +Q +
Sbjct: 387 SKSKRSRPISEITGSPVASSFLSSFSQSHESNPSVKLLFQDPATERNSNKSVFSSGLQCK 446

Query: 738 ITSASFADS------QAFSRQDFPDNXXXXXXXXXNVDFDDCSLR---QNSKGSSWQKIA 788
           IT A    S         S+               + +  D + +    NS  S  ++  
Sbjct: 447 ITEAPVTSSCRLFGFDLTSKPASATIPHDKQLISVDSNISDSTTKCQDPNSSNSPKEQKQ 506

Query: 789 TPRVRTYTKVQKTG-SVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVD 847
               R+  KVQ  G +VGR++D+T  + Y+EL   +E MF +EG L+      W +V+ D
Sbjct: 507 QTSTRSRIKVQMQGTAVGRAVDLTLLRSYDELIKELEKMFEIEGELSP--KDKWAIVFTD 564

Query: 848 YESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAGIN 895
            E D +LVGDDPW EF    + + I    EV++M  + +       +N
Sbjct: 565 DEGDRMLVGDDPWNEFCKMAKKLFIYPSDEVKKMRSKSLLGDKGTIVN 612


InterPro Results:

IPR003311 Family
PF02309 T[443-601] 3.4e-05 AUX_IAA
AUX/IAA protein
IPR003340 Family
PF02362 T[144-249] 3e-10 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[271-350] 4.6e-51 Auxin_resp
Auxin response factor
NULL
seg ?[9-26]?[401-417] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5584 e-167
TF_17_2 ARFNPH4/ARF7540 e-153
TF_17_3 ARFETTIN/ARF3518 e-147
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3150 3e-36
TF_55 Aux/IAA131 3e-31
TF_22_1 ABI3/VP1FUSCA3115 4e-26

TOP