AGI ID: At2g46310

TF ID:TF_2_5
Super family:AP2/EREBP
Sub family:DREB2A
Gene name: putative AP2 domain transcription factor

Amino Acid Sequence:


1
61
121
181
241
>At2g46310
MKSRVRKSKY TVHRKITSTP FDGFPKIVKI IVTDPCATDS SSDEENDNKS VAPRVKRYVD
EIRFCDEDDE PKPARKAKKK SPAAAAENGG DLVKSVVKYR GVRQRPWGKF AAEIRDPSSR
TRLWLGTFAT AEEAAIGYDR AAIRIKGHNA QTNFLTPPPS PTTEVLPETP VIDLETVSGC
DSARESQISL CSPTSVLRFS HNDETEYRTE PTEEQNPFFL PDLFRSGDYF WDSEITPDPL
FLDEFHQSLL PNINNNNTVC DKDTNLSDSF PLGVIGDFSS WDVDEFFQDH LLDK
Length = 294 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_5
Sbjct: At2g46310

>At2g46310 putative AP2 domain transcription factor
          Length = 294

 Score =  195 bits (496), Expect = 3e-50
 Identities = 56/251 (22%), Positives = 79/251 (31%), Gaps = 29/251 (11%)

Query: 28  DGTTVAERLKRWK-EYNETVEEVSTKKRKVPAXXXXXXXXXXXXXPENSRCSFRGVRQRI 86
           D  +VA R+KR+  E     E+   K  +                   S   +RGVRQR 
Sbjct: 47  DNKSVAPRVKRYVDEIRFCDEDDEPKPARKAKKKSPAAAAENGGDLVKSVVKYRGVRQRP 106

Query: 87  WGKWVAEIREPNRGSRLWLGTFPTXXXXXXXXXXXXXXMYGPLARLNF-PRSDAXXXXXX 145
           WGK+ AEIR+P+  +RLWLGTF T              + G  A+ NF     +      
Sbjct: 107 WGKFAAEIRDPSSRTRLWLGTFATAEEAAIGYDRAAIRIKGHNAQTNFLTPPPSPTTEVL 166

Query: 146 XXXXXXXXXXXPGCVHVKTEDPDCESKP----FSGGVEPMYCLENGAEEMKRGVKADKHW 201
                       GC   +       S      FS   E  Y  E   E+       +  +
Sbjct: 167 PETPVIDLETVSGCDSARESQISLCSPTSVLRFSHNDETEYRTEPTEEQ-------NPFF 219

Query: 202 LSEFEHN---YWS-----DILKEKE-----KQKEQGIVETCQQQQQDSLSVADYGWPNDV 248
           L +   +   +W      D L   E               C  +  +       G   D 
Sbjct: 220 LPDLFRSGDYFWDSEITPDPLFLDEFHQSLLPNINNNNTVC-DKDTNLSDSFPLGVIGDF 278

Query: 249 DQSHLDSSDMF 259
             S  D  + F
Sbjct: 279 --SSWDVDEFF 287


InterPro Results:

IPR001471 Domain
PD001423 T[105-145] 8e-17 sp_O82339_ARATH_O82339;
PR00367 T[99-110] 5.7e-11T[121-137] 5.7e-11 ETHRSPELEMNT
PF00847 T[97-160] 2e-33 AP2
SM00380 T[98-161] 1.3e-34 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[39-48]?[71-86] seg
SSF54171 T[97-157] 8.2e-22 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_5 AP2/EREBPDREB2A195 3e-50
TF_67 Pti6146 9e-36
TF_2_4 AP2/EREBPCBF1121 2e-28
TF_2_3 AP2/EREBPAPETALA2121 8e-28
TF_2_2 AP2/EREBPAINTEGUMENTA118 8e-27
TF_68 ERF114 4e-26
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 88 6e-18
TF_65 Pti4 87 8e-18
TF_66 Pti5 77 4e-15

TOP