AGI ID: At2g42660

TF ID:TF_1_6
Super family:MYB superfamily
Sub family:CIRCADIAN CLOCK ASSOCIATED 1
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
>At2g42660
MAGRSSPGKC STWLDLNREE TVEKNNEEES SVEDEDQITN NVRQYIRSNM PRLRWTPDLH
LSFVRAVQRL GGPDRATPKL VLEMMNLKGL SIAHVKSHLQ MYRSKKLEPS SRPGFGAFMS
GQRSYLMDMI DSRCIPHSDL RHAYNSKTVP SRVLNQDAVV TNLGGNFLMR PSSWFSGLCR
NDRDSTENKT LPLLEIRKKN NEKRVRDEEV SSVKRLKSMS GGGIQLPEFG NCRQKPTDDI
NTMLSLSLLS TSSEP
Length = 255 AA.

PSI BLAST Result:

Query: Query sequence of TF_1_6
Sbjct: At2g42660

>At2g42660 putative protein
          Length = 255

 Score =  137 bits (346), Expect = 2e-32
 Identities = 44/236 (18%), Positives = 72/236 (29%), Gaps = 49/236 (20%)

Query: 2   ETNSSGEDLVIKTRKPYTIT--KQRERWTEEEHNRFIEALRLYGR----AWQKIEE--HV 53
           E +S  ++  I       I     R RWT + H  F+ A++  G       + + E  ++
Sbjct: 28  EESSVEDEDQITNNVRQYIRSNMPRLRWTPDLHLSFVRAVQRLGGPDRATPKLVLEMMNL 87

Query: 54  ATKTAVQIRSHAQKFFSKVEKEAEAKGVAMGQALDIAIXXXXXXXXXXXXXXXXTGSGTI 113
              +   ++SH Q + SK  + +                                G G  
Sbjct: 88  KGLSIAHVKSHLQMYRSKKLEPSSR-----------------------------PGFGAF 118

Query: 114 LMSKTGVNDGKESLGSEKVSHPEMANEDRQQSKPEEKTLQEDNCSDCFTH---QYLSAAS 170
           +  +               S    A         +    +  N     T+    +L   S
Sbjct: 119 MSGQRSYLMDMIDSRCIPHSDLRHAYN------SKTVPSRVLNQDAVVTNLGGNFLMRPS 172

Query: 171 SMNKSCIETSNASTFREFLPSREEGSQNN--RVRKESNSDL-NAKSLENGNEQGPQ 223
           S           ST  + LP  E   +NN  RVR E  S +   KS+  G  Q P+
Sbjct: 173 SWFSGLCRNDRDSTENKTLPLLEIRKKNNEKRVRDEEVSSVKRLKSMSGGGIQLPE 228


InterPro Results:

IPR001005 Domain
PF00249 T[52-103] 4e-11 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[50-106] 8.4e-28 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[46-110] 9.2e-17 Homeodomain-like
Homeodomain-like
NULL
seg ?[19-36]?[244-253] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1137 2e-32
TF_10_1 GARPG2-like108 2e-23
TF_10_2 GARPARR-B class 89 4e-19
TF_1_2 MYB superfamilyLHY 70 4e-12

TOP