AGI ID: At2g40970

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
>At2g40970
MREDNPNWFL RWEEELPSPE ELIPISQTLI TPHLALAFQI GSPNHHLGSK RTTAIYHQKL
QSSTTPTTPT PTPPPMMMNS DFGGGDSTDL GSGSIGGEPA RTLKRPRLVW TPQLHKRFVD
AVGHLGIKNA VPKTIMQLMS VEGLTRENVA SHLQKYRLYL RRMQGGNGNG ITGGHVIVSD
SATDRLFASS PVPAHFLSPD YLMPPLEHSY MGKHVITQQN QVVRNLRYED SEYGHGSMKM
LKLFPAGN
Length = 248 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At2g40970

>At2g40970 unknown protein
          Length = 248

 Score =  109 bits (273), Expect = 5e-24
 Identities = 34/64 (53%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 182 ATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRL 241
           A    + RL WTP+LH RFV+AV  LG  + A PK I++LM V+GLT  ++ SHLQKYRL
Sbjct: 100 ARTLKRPRLVWTPQLHKRFVDAVGHLGIKN-AVPKTIMQLMSVEGLTRENVASHLQKYRL 158

Query: 242 NIRL 245
            +R 
Sbjct: 159 YLRR 162


InterPro Results:

IPR001005 Domain
PF00249 T[107-157] 1.2e-09 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[105-160] 3e-28 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[101-164] 2.9e-20 Homeodomain-like
Homeodomain-like
NULL
seg ?[13-26]?[64-75]?[80-97]?[165-174] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like109 5e-24
TF_10_2 GARPARR-B class101 7e-23
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 80 4e-15
TF_1_2 MYB superfamilyLHY 70 3e-12

TOP