AGI ID: At2g40260

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At2g40260
MRSSSQNSEN SKTCLSNNIK ATTKNEEDKD EEDDEEGEED EEERSGDQSP SSNSYEEESG
SHHHDQNKKN GGSVRPYNRS KTPRLRWTPE LHICFLQAVE RLGGPDRATP KLVLQLMNVK
GLSIAHVKSH LQMYRSKKTD EPNEGDQGFS FEHGAGYTYN LSQLPMLQSF DQRPSSSLGY
GGGSWTDHRR QIYRSPWRGL TTRENTRTRQ TMFSSQPGER YHGVSNSILN DKNKTISFRI
NSHEGVHDNN GVAGAVPRIH RSFLEGMKTF NKSWGQSLSS NLKSSTATIP QDHIATTLNS
YQWENAGVAE GSENVLKRKR LLFSDDCNKS DQDLDLSLSL KVPRTHDNLG ECLLEDEVKE
HDDHQDIKSL SLSLSSSGSS KLDRTIRKED QTDHKKRKIS VLASPLDLTL
Length = 410 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At2g40260

>At2g40260 hypothetical protein
          Length = 410

 Score =  111 bits (278), Expect = 1e-24
 Identities = 37/61 (60%), Positives = 43/61 (69%)

Query: 180 RAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKY 239
           R        RLRWTPELH  F+ AV  LGGPD+ATPK +L+LM V GL+I H+KSHLQ Y
Sbjct: 75  RPYNRSKTPRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHLQMY 134

Query: 240 R 240
           R
Sbjct: 135 R 135


InterPro Results:

IPR001005 Domain
PF00249 T[84-135] 2.3e-12 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[82-138] 3.9e-31 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[78-142] 2.1e-18 Homeodomain-like
Homeodomain-like
NULL
seg ?[26-43]?[330-340]?[368-382] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like111 1e-24
TF_10_2 GARPARR-B class 92 6e-20
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 75 2e-13
TF_1_2 MYB superfamilyLHY 69 7e-12

TOP