AGI ID: At2g38300

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
>At2g38300
MIPSMEGGGK TNREEEEEEE EEEEEGEESK VSSNSTVEES DKKTKVRPYV RSKVPRLRWT
PDLHLRFVRA VERLGGQERA TPKLVRQMMN IKGLSIAHVK SHLQMYRSKK IDDQGQAIAG
HKHLFETSTD RNIYKLSQLP MFRGYNHNHD SPFRYGSKIS NASLWNSSSQ GTERSLIDQI
RPGLIRNASV SNNIRGSDYW TNNKSFQNIY SSSISNHFPK LRHDHHERTN SVTFNSIQGH
SRTFQKFHNG VEENTNHSYC SKTNGKRDAS RSIDLDLSLK LRQPEKTILE ETETAATTTD
QTLSLSLCPG SSSWKKSRLM KDEEDRTVKI GQESTLDLTL
Length = 340 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At2g38300

>At2g38300 unknown protein
          Length = 340

 Score =  105 bits (263), Expect = 8e-23
 Identities = 33/61 (54%), Positives = 42/61 (68%)

Query: 180 RAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKY 239
           R        RLRWTP+LH RFV AV  LGG ++ATPK + ++M + GL+I H+KSHLQ Y
Sbjct: 47  RPYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQMY 106

Query: 240 R 240
           R
Sbjct: 107 R 107


InterPro Results:

IPR001005 Domain
PF00249 T[56-107] 6.1e-12 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[55-110] 6.7e-27 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[50-114] 8.5e-17 Homeodomain-like
Homeodomain-like
NULL
coil ?[12-33] coiled-coil
seg ?[14-28]?[290-299] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like105 8e-23
TF_10_2 GARPARR-B class 87 1e-18
TF_1_2 MYB superfamilyLHY 73 4e-13
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 73 6e-13

TOP