AGI ID: At2g36450

TF ID:TF_2_4
Super family:AP2/EREBP
Sub family:CBF1
Gene name: putative AP2 domain transcription factor

Amino Acid Sequence:


1
61
121
181
>At2g36450
MQGTSKDNGG RHPLYRGVRQ RKNSNKWVSE IREPRKPNRI WLGTFSTPEM AAIAYDVAAL
ALKGSQAELN FPNSVSSLPA PTSMSPADIQ AAAASAAAAF GAARDAIVMA NNNSQTSGVA
CMNSSYDNTN MNGFMDEDLV FDMPNVLMNM AEGMLLSPPR PTVFDAAYDA DGFPGGDDYL
WNFP
Length = 184 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_4
Sbjct: At2g36450

>At2g36450 putative AP2 domain transcription factor
          Length = 184

 Score =  171 bits (433), Expect = 3e-43
 Identities = 69/204 (33%), Positives = 96/204 (46%), Gaps = 37/204 (18%)

Query: 18  GRRVFKETRHPVYRGIRRRNG-DKWVCEVREPTHQRRIWLGTYPTADMAARAHDVAVLAL 76
           G       RHP+YRG+R+R   +KWV E+REP    RIWLGT+ T +MAA A+DVA LAL
Sbjct: 3   GTSKDNGGRHPLYRGVRQRKNSNKWVSEIREPRKPNRIWLGTFSTPEMAAIAYDVAALAL 62

Query: 77  RGRSACLNFADSAWRLPVPESNDPDVIRRVAAEAAE----------MFRPVDLESGITVL 126
           +G  A LNF +S   LP P S  P  I+  AA AA           M       SG+  +
Sbjct: 63  KGSQAELNFPNSVSSLPAPTSMSPADIQAAAASAAAAFGAARDAIVMANNNSQTSGVACM 122

Query: 127 PCAGDDVDLXXXXXXXXXXXXXXXXXXXXXFGDYE---EVSTTMMRLAEGPLMSPPRSYM 183
             + D+ ++                     F D +   ++   +M +AEG L+SPPR  +
Sbjct: 123 NSSYDNTNM-------------------NGFMDEDLVFDMPNVLMNMAEGMLLSPPRPTV 163

Query: 184 EDMTPTNVYTEEEMCYEDMSLWSY 207
            D      Y  +     D  LW++
Sbjct: 164 FD----AAYDADGFPGGDDYLWNF 183


InterPro Results:

IPR001471 Domain
PD001423 T[26-65] 3e-10 sp_Q9SJR0_ARATH_Q9SJR0;
PR00367 T[15-26] 2.5e-09T[54-74] 2.5e-09 ETHRSPELEMNT
PF00847 T[13-77] 5.5e-33 AP2
SM00380 T[14-78] 2e-32 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[51-61]?[87-106] seg
SSF54171 T[13-75] 1.8e-21 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_4 AP2/EREBPCBF1171 3e-43
TF_2_2 AP2/EREBPAINTEGUMENTA120 3e-27
TF_68 ERF112 1e-25
TF_2_3 AP2/EREBPAPETALA2109 3e-24
TF_67 Pti6108 4e-24
TF_2_5 AP2/EREBPDREB2A 91 1e-18
TF_66 Pti5 84 3e-17
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 85 4e-17
TF_65 Pti4 80 1e-15

TOP