AGI ID: At2g36080

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: putative RAV2-like DNA binding protein

Amino Acid Sequence:


1
61
121
>At2g36080
MWQQQQQQQQ HQNDVVEEKE ALFEKPLTPS DVGKLNRLVI PKQHAERYFP LAAAAADAVE
KGLLLCFEDE EGKPWRFRYS YWNSSQSYVL TKGWSRYVKE KHLDAGDVVL FHRHRSDGGR
FFIGWRRRGD SSSSSDSYRH VQSNASLQYY PHAGTLFI
Length = 158 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At2g36080

>At2g36080 putative RAV2-like DNA binding protein
          Length = 158

 Score =  165 bits (417), Expect = 1e-40
 Identities = 36/111 (32%), Positives = 50/111 (44%), Gaps = 4/111 (3%)

Query: 152 KHPTEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDYSAQ--PPTQELVVRDLHENTWT 209
           +     F K LT SD        +P++ AE+ FP    +A        L   D     W 
Sbjct: 17  EEKEALFEKPLTPSDVGKLNRLVIPKQHAERYFPLAAAAADAVEKGLLLCFEDEEGKPWR 76

Query: 210 FRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLF--IRDEKSQLMVGVRR 258
           FR+ Y    + ++LT GWS +V  K L AGD VLF   R +  +  +G RR
Sbjct: 77  FRYSYWNSSQSYVLTKGWSRYVKEKHLDAGDVVLFHRHRSDGGRFFIGWRR 127


InterPro Results:

IPR003340 Family
PF02362 T[22-131] 3.8e-27 B3
Transcriptional factor B3
IPR008994 Domain
SSF50249 T[57-127] 0.00048 Nucleic acid-binding proteins
Nucleic acid-binding OB-fold
NULL
seg ?[3-12]?[118-129]?[130-137] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5165 1e-40
TF_17_3 ARFETTIN/ARF3154 1e-37
TF_17_2 ARFNPH4/ARF7145 1e-34
TF_22_1 ABI3/VP1FUSCA3121 5e-28
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3109 5e-24

TOP