AGI ID: At2g35310

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
>At2g35310
MARNSDNDMC KEERKRESFF KVLQRVDISS ENMRALPYDF VRSFSNNELS RKMKIKARWG
SSWEVEICKN PRFYFMEKSG WEKFVSDNAL GASEFLTFTH KGNMRFTVNI FMQDGKEMLQ
PPQSMSFMAS SRPPKREQGI PSLATTIAAE SNGGGNYKRK LNFEKKKAEE SHNSKRTDKV
FSVQRESAGA SSSSVAEFSM FIKKSYLIYM YSYAEAENDF QDTSPKYEEV MECGLRGVRD
EIKLLCWMER FGSRISSSSW RHLQVFIHQT TRADSLCLKT LRGDSLVNSD DECEGVY
Length = 297 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At2g35310

>At2g35310 hypothetical protein
          Length = 297

 Score = 94.6 bits (234), Expect = 2e-19
 Identities = 20/116 (17%), Positives = 33/116 (28%), Gaps = 10/116 (8%)

Query: 564 EKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRY 623
           E+  R    KVL++ D+ +     LP     +      +R     A         W +  
Sbjct: 12  EERKRESFFKVLQRVDISSENMRALPYDFVRSFSNNELSRKMKIKA----RWGSSWEVEI 67

Query: 624 RFWPNNKSRMYLLE-NTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQPSGQKPEA 678
                N    ++ +     FV  N L   +F+      K      V        E 
Sbjct: 68  CK---NPRFYFMEKSGWEKFVSDNALGASEFLTFT--HKGNMRFTVNIFMQDGKEM 118


InterPro Results:

IPR003340 Family
PF02362 T[18-116] 2e-06 B3
Transcriptional factor B3
NULL
seg ?[187-199] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 95 2e-19

TOP