AGI ID: At2g33860

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: auxin response transcription factor 3 (ETTIN/ARF3)

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At2g33860
MGGLIDLNVM ETEEDETQTQ TPSSASGSVS PTSSSSASVS VVSSNSAGGG VCLELWHACA
GPLISLPKRG SLVLYFPQGH LEQAPDFSAA IYGLPPHVFC RILDVKLHAE TTTDEVYAQV
SLLPESEDIE RKVREGIIDV DGGEEDYEVL KRSNTPHMFC KTLTASDTST HGGFSVPRRA
AEDCFPPLDY SQPRPSQELL ARDLHGLEWR FRHIYRGQPR RHLLTTGWSA FVNKKKLVSG
DAVLFLRGDD GKLRLGVRRA SQIEGTAALS AQYNQNMNHN NFSEVAHAIS THSVFSISYN
PKASWSNFII PAPKFLKVVD YPFCIGMRFK ARVESEDASE RRSPGIISGI SDLDPIRWPG
SKWRCLLVRW DDIVANGHQQ RVSPWEIEPS GSISNSGSFV TTGPKRSRIG FSSGKPDIPV
SEGIRATDFE ESLRFQRVLQ GQEIFPGFIN TCSDGGAGAR RGRFKGTEFG DSYGFHKVLQ
GQETVPAYSI TDHRQQHGLS QRNIWCGPFQ NFSTRILPPS VSSSPSSVLL TNSNSPNGRL
EDHHGGSGRC RLFGFPLTDE TTAVASATAV PCVEGNSMKG ASAVQSNHHH SQGRDIYAMR
DMLLDIAL
Length = 608 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At2g33860

>At2g33860 auxin response transcription factor 3 (ETTIN/ARF3)
          Length = 608

 Score =  924 bits (2388), Expect = 0.0
 Identities = 537/608 (88%), Positives = 537/608 (88%)

Query: 1   MGGLIDLNVMXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCLELWHACA 60
           MGGLIDLNVM           P                             CLELWHACA
Sbjct: 1   MGGLIDLNVMETEEDETQTQTPSSASGSVSPTSSSSASVSVVSSNSAGGGVCLELWHACA 60

Query: 61  GPLISLPKRGSLVLYFPQGHLEQAPDFSAAIYGLPPHVFCRILDVKLHAETTTDEVYAQV 120
           GPLISLPKRGSLVLYFPQGHLEQAPDFSAAIYGLPPHVFCRILDVKLHAETTTDEVYAQV
Sbjct: 61  GPLISLPKRGSLVLYFPQGHLEQAPDFSAAIYGLPPHVFCRILDVKLHAETTTDEVYAQV 120

Query: 121 SLLPESEDIERKVREGIIDVDGGEEDYEVLKRSNTPHMFCKTLTASDTSTHGGFSVPRRA 180
           SLLPESEDIERKVREGIIDVDGGEEDYEVLKRSNTPHMFCKTLTASDTSTHGGFSVPRRA
Sbjct: 121 SLLPESEDIERKVREGIIDVDGGEEDYEVLKRSNTPHMFCKTLTASDTSTHGGFSVPRRA 180

Query: 181 AEDCFPPLDYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSG 240
           AEDCFPPLDYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSG
Sbjct: 181 AEDCFPPLDYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSG 240

Query: 241 DAVLFLRGDDGKLRLGVRRASQIEGTAALSAQYNQNMNHNNFSEVAHAISTHSVFSISYN 300
           DAVLFLRGDDGKLRLGVRRASQIEGTAALSAQYNQNMNHNNFSEVAHAISTHSVFSISYN
Sbjct: 241 DAVLFLRGDDGKLRLGVRRASQIEGTAALSAQYNQNMNHNNFSEVAHAISTHSVFSISYN 300

Query: 301 PKASWSNFIIPAPKFLKVVDYPFCIGMRFKARVESEDASERRSPGIISGISDLDPIRWPG 360
           PKASWSNFIIPAPKFLKVVDYPFCIGMRFKARVESEDASERRSPGIISGISDLDPIRWPG
Sbjct: 301 PKASWSNFIIPAPKFLKVVDYPFCIGMRFKARVESEDASERRSPGIISGISDLDPIRWPG 360

Query: 361 SKWRCLLVRWDDIVANGHQQRVSPWEIEPSGSISNSGSFVTTGPKRSRIGISSGKPDIPV 420
           SKWRCLLVRWDDIVANGHQQRVSPWEIEPSGSISNSGSFVTTGPKRSRIG SSGKPDIPV
Sbjct: 361 SKWRCLLVRWDDIVANGHQQRVSPWEIEPSGSISNSGSFVTTGPKRSRIGFSSGKPDIPV 420

Query: 421 SEGIRATDFEESLRFQRVLQGQEIFPGFINTCSDXXXXXXXXXFKGTEFGDSYGFHKVLQ 480
           SEGIRATDFEESLRFQRVLQGQEIFPGFINTCSD         FKGTEFGDSYGFHKVLQ
Sbjct: 421 SEGIRATDFEESLRFQRVLQGQEIFPGFINTCSDGGAGARRGRFKGTEFGDSYGFHKVLQ 480

Query: 481 GQETVPAYSITDHRQQHGLSQRNIWCGPFQNFSTRIXXXXXXXXXXXXXXXXXXXXXGRL 540
           GQETVPAYSITDHRQQHGLSQRNIWCGPFQNFSTRI                     GRL
Sbjct: 481 GQETVPAYSITDHRQQHGLSQRNIWCGPFQNFSTRILPPSVSSSPSSVLLTNSNSPNGRL 540

Query: 541 EDHHGGSGRCRLFGFPLTDETTAVASATAVPCVEGNSMKGASAVQSNHHHSQGRDIYAMR 600
           EDHHGGSGRCRLFGFPLTDETTAVASATAVPCVEGNSMKGASAVQSNHHHSQGRDIYAMR
Sbjct: 541 EDHHGGSGRCRLFGFPLTDETTAVASATAVPCVEGNSMKGASAVQSNHHHSQGRDIYAMR 600

Query: 601 DMLLDIAL 608
           DMLLDIAL
Sbjct: 601 DMLLDIAL 608


InterPro Results:

IPR003340 Family
PF02362 T[158-263] 8.9e-12 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[285-367] 7e-55 Auxin_resp
Auxin response factor
NULL
seg ?[11-21]?[23-51]?[455-463]?[517-537] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3924 0.0
TF_17_1 ARFMONOPTEROS/ARF5491 e-139
TF_17_2 ARFNPH4/ARF7442 e-124
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3145 1e-34
TF_22_1 ABI3/VP1FUSCA3122 3e-28

TOP