AGI ID: At2g33720

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At2g33720
MKMPPPFSAS KTQYLFHDES SENSKKSLVS TTLSLSSCEN PNKRKMNSDE VLNISCIPRD
YKLTQVERKI ARMRNLSYQE KAEDEWYGVS TELTLFKDPW IIKKVFHFAS VLDMAPNSVS
NTHCLLDTES PENAEESLVS LDLCFYDKTW PHDPNVAYNK PTSEEAINLA WMRTMSKRAR
KEEEKYYVST ELTLLTVADP WTLKMAMTKS SIGNLYRLVL KASFVDIHIL RYLPLDDQMM
VKEDSGLAVE VYDHDTDSVH NLALKKWAKS SSFVLVSGWR KCFVDRRGLQ VGDVIGMYWD
RSESKLHFCV LSRSETMDSA PLPPSP
Length = 326 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At2g33720

>At2g33720 hypothetical protein
          Length = 326

 Score =  102 bits (255), Expect = 1e-21
 Identities = 17/130 (13%), Positives = 33/130 (25%), Gaps = 8/130 (6%)

Query: 98  TLQPVNKYDRDALLASDMGLKLNRQPNEFFCKTLTASDTSTHGGFSVPRR----AAEKIF 153
           T+    + + +    S     L           +T S         +          +  
Sbjct: 174 TMSKRARKEEEKYYVSTELTLLTVADPWTLKMAMTKSSIGNLYRLVLKASFVDIHILRYL 233

Query: 154 PALD--FSMQPPCQELVAKDIHDNT-WTFRHIYRGQPKRHLLTTGWSV-FVSTKRLFAGD 209
           P  D     +     +   D   ++          +    +L +GW   FV  + L  GD
Sbjct: 234 PLDDQMMVKEDSGLAVEVYDHDTDSVHNLALKKWAKSSSFVLVSGWRKCFVDRRGLQVGD 293

Query: 210 SVLFIRDGKA 219
            +    D   
Sbjct: 294 VIGMYWDRSE 303


InterPro Results:

NULL
seg ?[24-37] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7102 1e-21
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3101 1e-21
TF_22_1 ABI3/VP1FUSCA3 97 1e-20

TOP