AGI ID: At2g31720

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At2g31720
MVRGDDQLNG LQGGKRALDI LCVATERTVS AFAYEEIGET STEGDKRRER LRRLRRLINY
SLSTTMNSSL SKRLKIDECK NQDPEQNPNR VASSPSSCHL ESKRPQKVVS NKPVRNRKPV
IVTDEDRTPT EWLIDVMREV NGMDAKLIFV KVLPNSDVDE LQTRLMMPWK QILDMDFLNE
EELEKIDRHH KKISASDKGA DVIVVNSKGL QRKLKLKRWD MTSTSNYVLG LGWNKVVTDN
ILQRGTRLRI WSFHSPDMLF FAFVLSDPDP APTECLNLLA KLCEETTCLE ALQEANRMSS
LVSDTELDLE LRL
Length = 313 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At2g31720

>At2g31720 hypothetical protein
          Length = 313

 Score = 99.2 bits (246), Expect = 1e-20
 Identities = 17/131 (12%), Positives = 35/131 (25%), Gaps = 16/131 (12%)

Query: 108 DALLASDMGLKLNRQPNEFFCKTLTASDTST-HGGFSVPRRAA-------EKIFPALD-- 157
           + L+     +         F K L  SD         +P +         E+    +D  
Sbjct: 131 EWLIDVMREVNG-MDAKLIFVKVLPNSDVDELQTRLMMPWKQILDMDFLNEEELEKIDRH 189

Query: 158 ---FSMQPPCQELVAKDIHDNTWTFRHIYRGQ--PKRHLLTTGWSVFVSTKRLFAGDSVL 212
               S      +++  +        +           ++L  GW+  V+   L  G  + 
Sbjct: 190 HKKISASDKGADVIVVNSKGLQRKLKLKRWDMTSTSNYVLGLGWNKVVTDNILQRGTRLR 249

Query: 213 FIRDGKAQLLL 223
                   +L 
Sbjct: 250 IWSFHSPDMLF 260


InterPro Results:

IPR005508 Domain
PF03754 T[127-239] 2e-45 DUF313
Protein of unknown function DUF313
NULL
seg ?[47-57] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7 99 1e-20
TF_22_1 ABI3/VP1FUSCA3 96 2e-20
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 91 3e-18

TOP