AGI ID: At2g31460

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
>At2g31460
MSDSAEMQQP ELLLKSMNKL NGYHPQLIIP KKTLFKCDLD DKQSRLQVSS MHMENSGFLT
EDEKRTIEAQ KMKKRRTAGL RVAFIDPESQ QYVLELHKWT KSYAFVKGWN KVVDKNDKTF
KVGDVFSLWV FRCGGVNPVH DGVNLSGGHA DSVVDGLEQG SLCFVLVPAK VSVHDGNLPQ
DSGHDGHNDN LPQDSVEPSS FFDESYELNH LFFDQEDSQG YLPDEDEDFG FNDDGSIRDS
GHYQ
Length = 244 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At2g31460

>At2g31460 hypothetical protein
          Length = 244

 Score = 87.7 bits (216), Expect = 4e-17
 Identities = 18/131 (13%), Positives = 26/131 (19%), Gaps = 18/131 (13%)

Query: 100 QPVNKYDRDA--LLASDMGLKLNRQPNEFFCKTLTASDT-STHGGFSVPRRAAEK--IFP 154
              +   +    LL S   L           KTL   D         V     E      
Sbjct: 1   MSDSAEMQQPELLLKSMNKLNGYHPQLIIPKKTLFKCDLDDKQSRLQVSSMHMENSGFLT 60

Query: 155 ALDFSMQP---------PCQELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFV--STK 203
             +                  +   D     +          K +    GW+  V  + K
Sbjct: 61  EDEKRTIEAQKMKKRRTAGLRVAFIDPESQQYVLELHKW--TKSYAFVKGWNKVVDKNDK 118

Query: 204 RLFAGDSVLFI 214
               GD     
Sbjct: 119 TFKVGDVFSLW 129


InterPro Results:

IPR005508 Domain
PF03754 T[7-115] 4.9e-59 DUF313
Protein of unknown function DUF313
NULL
seg ?[224-235] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7 88 4e-17
TF_22_1 ABI3/VP1FUSCA3 67 1e-11
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 67 4e-11

TOP