AGI ID: At2g31420

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
>At2g31420
MEAYDICKFW KLDMLEEFSQ IVLKGKKKII LDIPSPSQQN KSDIVSLCPA DSPETCNSSI
PDWLVKVMRK ENGYDPKLII KRRVLCTTDL RKNQGCLSMH LSKLEKSDFL TEDETRFLDE
DFLKAKRDGL KVFLVDPESD KHVVYLKKWN GNTVWKYVLS HGWNNVIDKK IFKVNDVIEI
WSFRDGSGKL CFALSSPTRC GRSSSGHSS
Length = 209 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At2g31420

>At2g31420 hypothetical protein
          Length = 209

 Score =  106 bits (264), Expect = 1e-22
 Identities = 19/145 (13%), Positives = 37/145 (25%), Gaps = 18/145 (12%)

Query: 107 RDALLASDMGLKLNRQPNEFFCKTLTASDT-STHGGFSVPRRAAE----------KIFPA 155
            D L+                 + L  +D     G  S+     E          +    
Sbjct: 61  PDWLVKVMRKENGYDPKLIIKRRVLCTTDLRKNQGCLSMHLSKLEKSDFLTEDETRFLDE 120

Query: 156 LDFSMQPPCQELVAKDIHDNTWTFRHIYRGQP--KRHLLTTGWSVFVSTKRLFAGDSVLF 213
                +    ++   D   +               +++L+ GW+  +  K     D +  
Sbjct: 121 DFLKAKRDGLKVFLVDPESDKHVVYLKKWNGNTVWKYVLSHGWNNVIDKKIFKVNDVIEI 180

Query: 214 I--RDGKAQLLLGI---RRANRQQP 233
              RDG  +L   +    R  R   
Sbjct: 181 WSFRDGSGKLCFALSSPTRCGRSSS 205


InterPro Results:

IPR005508 Domain
PF03754 T[58-169] 2e-67 DUF313
Protein of unknown function DUF313

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7106 1e-22
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3101 1e-21
TF_22_1 ABI3/VP1FUSCA3 88 8e-18

TOP