AGI ID: At2g30470

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: putative VP1/ABI3 family regulatory protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
781
>At2g30470
MFEVKMGSKM CMNASCGTTS TVEWKKGWPL RSGLLADLCY RCGSAYESSL FCEQFHKDQS
GWRECYLCSK RLHCGCIASK VTIELMDYGG VGCSTCACCH QLNLNTRGEN PGVFSRLPMK
TLADRQHVNG ESGGRNEGDL FSQPLVMGGD KREEFMPHRG FGKLMSPEST TTGHRLDAAG
EMHESSPLQP SLNMGLAVNP FSPSFATEAV EGMKHISPSQ SNMVHCSASN ILQKPSRPAI
STPPVASKSA QARIGRPPVE GRGRGHLLPR YWPKYTDKEV QQISGNLNLN IVPLFEKTLS
ASDAGRIGRL VLPKACAEAY FPPISQSEGI PLKIQDVRGR EWTFQFRYWP NNNSRMYVLE
GVTPCIQSMM LQAGDTVTFS RVDPGGKLIM GSRKAANAGD MQGCGLTNGT STEDTSSSGV
TENPPSINGS SCISLIPKEL NGMPENLNSE TNGGRIGDDP TRVKEKKRTR TIGAKNKRLL
LHSEESMELR LTWEEAQDLL RPSPSVKPTI VVIEEQEIEE YDEPPVFGKR TIVTTKPSGE
QERWATCDDC SKWRRLPVDA LLSFKWTCID NVWDVSRCSC SAPEESLKEL ENVLKVGREH
KKRRTGESQA AKSQQEPCGL DALASAAVLG DTIGEPEVAT TTRHPRHRAG CSCIVCIQPP
SGKGRHKPTC GCTVCSTVKR RFKTLMMRRK KKQLERDVTA AEDKKKKDME LAESDKSKEE
KEVNTARIDL NSDPYNKEDV EAVAVEKEES RKRAIGQCSG VVAQDASDVL GVTELEGEGK
NVREEPRVSS
Length = 790 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At2g30470

>At2g30470 putative VP1/ABI3 family regulatory protein
          Length = 790

 Score =  160 bits (406), Expect = 2e-39
 Identities = 43/157 (27%), Positives = 70/157 (44%), Gaps = 8/157 (5%)

Query: 146 DYEVLKRSNTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQPRPSQELLARDLH 205
                   N   +F KTL+ASD    G   +P+  AE  FPP+  S+  P   L  +D+ 
Sbjct: 282 QISGNLNLNIVPLFEKTLSASDAGRIGRLVLPKACAEAYFPPISQSEGIP---LKIQDVR 338

Query: 206 GLEWRFRHIYR-GQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR-GDDGKLRLGVRRASQ- 262
           G EW F+  Y      R  +  G +  +    L +GD V F R    GKL +G R+A+  
Sbjct: 339 GREWTFQFRYWPNNNSRMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGGKLIMGSRKAANA 398

Query: 263 --IEGTAALSAQYNQNMNHNNFSEVAHAISTHSVFSI 297
             ++G    +    ++ + +  +E   +I+  S  S+
Sbjct: 399 GDMQGCGLTNGTSTEDTSSSGVTENPPSINGSSCISL 435


InterPro Results:

IPR003340 Family
PF02362 T[294-398] 3.5e-25 B3
Transcriptional factor B3
IPR011124 Domain
PF07496 T[542-587] 1.6e-19 zf-CW
CW-type Zn-finger
NULL
coil ?[691-730] coiled-coil
seg ?[508-526]?[737-749] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3160 2e-39
TF_17_1 ARFMONOPTEROS/ARF5152 6e-37
TF_17_2 ARFNPH4/ARF7128 2e-29
TF_22_1 ABI3/VP1FUSCA3122 3e-28
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3113 4e-25

TOP