AGI ID: At2g28350

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
>At2g28350
MEQEKSLDPQ LWHACAGSMV QIPSLNSTVF YFAQGHTEHA HAPPDFHAPR VPPLILCRVV
SVKFLADAET DEVFAKITLL PLPGNDLDLE NDAVLGLTPP SSDGNGNGKE KPASFAKTLT
QSDANNGGGF SVPRYCAETI FPRLDYSAEP PVQTVIAKDI HGETWKFRHI YRGTPRRHLL
TTGWSTFVNQ KKLIAGDSIV FLRSESGDLC VGIRRAKRGG LGSNAGSDNP YPGFSGFLRD
DESTTTTSKL MMMKRNGNND GNAAATGRVR VEAVAEAVAR AACGQAFEVV YYPRASTPEF
CVKAADVRSA MRIRWCSGMR FKMAFETEDS SRISWFMGTV SAVQVADPIR WPNSPWRLLQ
VAWDEPDLLQ NVKRVSPWLV ELVSNMPTIH LSPFSPRKKI RIPQPFEFPF HGTKFPIFSP
GFANNGGGES MCYLSNDNNN APAGIQGARQ AQQLFGSPSP SLLSDLNLSS YTGNNKLHSP
AMFLSSFNPR HHHYQARDSE NSNNISCSLT MGNPAMVQDK KKSVGSVKTH QFVLFGQPIL
TEQQVMNRKR FLEEEAEAEE EKGLVARGLT WNYSLQGLET GHCKVFMESE DVGRTLDLSV
IGSYQELYRK LAEMFHIEER SDLLTHVVYR DANGVIKRIG DEPFSDFMKA TKRLTIKMDI
GGDNVRKTWI TGIRTGENGI DASTKTGPLS IFA
Length = 693 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At2g28350

>At2g28350 unknown protein
          Length = 693

 Score =  457 bits (1177), Expect = e-129
 Identities = 155/408 (37%), Positives = 204/408 (49%), Gaps = 53/408 (12%)

Query: 54  ELWHACAGPLISLPKRGSLVLYFPQGHLEQA---PDFSAAIYGLPPHVFCRILDVKLHAE 110
           +LWHACAG ++ +P   S V YF QGH E A   PDF A    +PP + CR++ VK  A+
Sbjct: 10  QLWHACAGSMVQIPSLNSTVFYFAQGHTEHAHAPPDFHAP--RVPPLILCRVVSVKFLAD 67

Query: 111 TTTDEVYAQVSLLPE---SEDIERKVREGIID--VDGGEEDYEVLKRSNTPHMFCKTLTA 165
             TDEV+A+++LLP      D+E     G+     DG             P  F KTLT 
Sbjct: 68  AETDEVFAKITLLPLPGNDLDLENDAVLGLTPPSSDGNGN------GKEKPASFAKTLTQ 121

Query: 166 SDTSTHGGFSVPRRAAEDCFPPLDYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLT 225
           SD +  GGFSVPR  AE  FP LDYS   P Q ++A+D+HG  W+FRHIYRG PRRHLLT
Sbjct: 122 SDANNGGGFSVPRYCAETIFPRLDYSAEPPVQTVIAKDIHGETWKFRHIYRGTPRRHLLT 181

Query: 226 TGWSAFVNKKKLVSGDAVLFLRGDDGKLRLGVRRASQ----------------------I 263
           TGWS FVN+KKL++GD+++FLR + G L +G+RRA +                       
Sbjct: 182 TGWSTFVNQKKLIAGDSIVFLRSESGDLCVGIRRAKRGGLGSNAGSDNPYPGFSGFLRDD 241

Query: 264 EGTAALSAQYNQNMNHNNFSEVAHA--------------ISTHSVFSISYNPKASWSNFI 309
           E T   S       N NN    A                 +    F + Y P+AS   F 
Sbjct: 242 ESTTTTSKLMMMKRNGNNDGNAAATGRVRVEAVAEAVARAACGQAFEVVYYPRASTPEFC 301

Query: 310 IPAPKFLKVVDYPFCIGMRFKARVESEDASE-RRSPGIISGISDLDPIRWPGSKWRCLLV 368
           + A      +   +C GMRFK   E+ED+S      G +S +   DPIRWP S WR L V
Sbjct: 302 VKAADVRSAMRIRWCSGMRFKMAFETEDSSRISWFMGTVSAVQVADPIRWPNSPWRLLQV 361

Query: 369 RWDDIVANGHQQRVSPWEIEPSGSISNSGSFVTTGPKRSRIGISSGKP 416
            WD+     + +RVSPW +E   ++        +  K+ RI      P
Sbjct: 362 AWDEPDLLQNVKRVSPWLVELVSNMPTIHLSPFSPRKKIRIPQPFEFP 409


InterPro Results:

IPR003340 Family
PF02362 T[114-219] 1.4e-11 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[277-360] 6.4e-48 Auxin_resp
Auxin response factor
NULL
coil ?[542-563] coiled-coil
seg ?[243-248]?[256-282]?[457-470]?[553-561] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3457 e-129
TF_17_1 ARFMONOPTEROS/ARF5446 e-125
TF_17_2 ARFNPH4/ARF7255 1e-67
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3126 6e-29
TF_22_1 ABI3/VP1FUSCA3115 3e-26
TF_55 Aux/IAA 79 2e-15

TOP