AGI ID: At2g27410

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At2g27410
MAKPGFNRNK KMVKHDDLIV SLMSRISEDT LLEIVGQRVE NMYANHTESQ TTSPGKHQTV
DPNISGDAVP IKKRGPCHRS SSSPTKTTTC TRALEQQRSI TSVEPVLHKT LIEEEPIQTT
PPEWLLNVMR REENGYNPKL ISTRQLYKTD LKKTEARLSV PFKQVKTPDF LTEDETRIIH
ENAMKIRDNG VPVNFVDPEL NKHVLELRKW KMKGNWIYVF VKGWKNVLDA CKTLFKEDDV
YPLWSFRSGT GKLCFALTPK NSGRGNSLPG GDGASTSGES GQVPLPIPPA RYSSNSGQGC
SGESSSSSS
Length = 309 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At2g27410

>At2g27410 hypothetical protein
          Length = 309

 Score =  108 bits (269), Expect = 2e-23
 Identities = 18/155 (11%), Positives = 38/155 (23%), Gaps = 17/155 (10%)

Query: 97  MTLQPVNKYDRDALLASDMGLKLNRQPNEFFCKTLTASDTST-HGGFSVPRRAAEK--IF 153
           +  +P+     + LL      +    P     + L  +D        SVP +  +     
Sbjct: 112 IEEEPIQTTPPEWLLNVMRREENGYNPKLISTRQLYKTDLKKTEARLSVPFKQVKTPDFL 171

Query: 154 PALD--------FSMQPPCQELVAKDIHDNTWTFRHIYRGQPKR--HLLTTGWSVFVSTK 203
              +          ++     +   D   N                ++   GW   +   
Sbjct: 172 TEDETRIIHENAMKIRDNGVPVNFVDPELNKHVLELRKWKMKGNWIYVFVKGWKNVLDAC 231

Query: 204 R--LFAGDSVLFI--RDGKAQLLLGIRRANRQQPA 234
           +      D       R G  +L   +   N  +  
Sbjct: 232 KTLFKEDDVYPLWSFRSGTGKLCFALTPKNSGRGN 266


InterPro Results:

IPR005508 Domain
PF03754 T[119-230] 4.4e-68 DUF313
Protein of unknown function DUF313
NULL
seg ?[80-91]?[112-123]?[293-309] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7108 2e-23
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 90 4e-18
TF_22_1 ABI3/VP1FUSCA3 83 2e-16

TOP