AGI ID: At2g27070

TF ID:TF_1_6
Super family:MYB superfamily
Sub family:CIRCADIAN CLOCK ASSOCIATED 1
Gene name: putative two-component response regulator protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
>At2g27070
MAFAQSVYNQ SSVLKINVMV VDDNRVFLDI WSRMLEKSKY REITVIAVDY PKKALSTLKN
QRDNIDLIIT DYYMPGMNGL QLKKQITQEF GNLSVLVMSS DPNKEEESLS CGAMGFIPKP
IAPTDLPKIY QFALTYKRNG KSTLSTEQNQ KDANVSVPQQ IMLVPEQAYV LKTKKKNCSS
KSDTRTVNST NVSHVSTNGS RKNRKRKPKG GPSDDGESLS QPPKKKKIWW TNPLQDLFLQ
AIQHIGYDKV VPKKILAIMN VPYLTRENVA SHLQKYRLFV KRVVHQGRFS MLSDRGKDSM
FRQTHIKEPY VNYYTPSTSW YETSLNNRSF YSESVHGHSR LLSEAREPVR YNQMSYNYMN
RNISFENQPS QNEETRTVFE PPVMANKISQ TSQVLGFGQL GPSAISGHNF NTNMMSSYGS
LTPNQPGTSH FSYGMQSVLN NENATYNPQP PANATTQPNL DELPQLENLN LYNDLGNTSE
LPYNISNFQS DDNKKQGEED GDWTFVNINQ DQSNGESSNT IATPETNTPN FNINPNQNQG
QAVPEFTDWS FLDQQPRRLG IRIGYFGFKF SGLEV
Length = 575 AA.

PSI BLAST Result:

Query: Query sequence of TF_1_6
Sbjct: At2g27070

>At2g27070 putative two-component response regulator protein
          Length = 575

 Score =  114 bits (286), Expect = 2e-25
 Identities = 25/211 (11%), Positives = 51/211 (23%), Gaps = 21/211 (9%)

Query: 8   EDLVIKTRK-PYTITKQRERWTEEEHNRFIEALRLYGRA---WQKIEE--HVATKTAVQI 61
                          K++  WT    + F++A++  G      +KI    +V   T   +
Sbjct: 210 GGPSDDGESLSQPPKKKKIWWTNPLQDLFLQAIQHIGYDKVVPKKILAIMNVPYLTRENV 269

Query: 62  RSHAQKFFSKVEKEAEAKGVAMGQALDIAIXXXXXXXXXXXXXXXXTGSG--TILMSKTG 119
            SH QK+   V++       +M                          +      ++   
Sbjct: 270 ASHLQKYRLFVKRVVHQGRFSMLSDRGKDSMFRQTHIKEPYVNYYTPSTSWYETSLNNRS 329

Query: 120 VNDGKESLGS-------EKVSHPEMANEDRQQ-SKPEEKTLQEDNCSDCFTHQ-----YL 166
                    S       E V + +M+     +    E +  Q +     F          
Sbjct: 330 FYSESVHGHSRLLSEAREPVRYNQMSYNYMNRNISFENQPSQNEETRTVFEPPVMANKIS 389

Query: 167 SAASSMNKSCIETSNASTFREFLPSREEGSQ 197
             +  +    +  S  S              
Sbjct: 390 QTSQVLGFGQLGPSAISGHNFNTNMMSSYGS 420


InterPro Results:

IPR001789 Domain
PD000039 T[16-126] 2e-57 sp_Q9ZVD3_ARATH_Q9ZVD3;
PF00072 T[16-138] 2e-23 Response_reg
SM00448 T[16-130] 5.7e-19 REC
PS50110 T[17-134] 23.839 RESPONSE_REGULATORY
Response regulator receiver
IPR006447 Domain
TIGR01557 T[225-280] 6.3e-36 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[221-283] 1e-17 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[15-152] 7.8e-22 CheY-like
CheY-like
NULL
seg ?[198-213]?[523-541] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1114 2e-25
TF_10_2 GARPARR-B class 94 2e-20
TF_10_1 GARPG2-like 96 7e-20
TF_1_2 MYB superfamilyLHY 71 2e-12

TOP