AGI ID: At2g25180

TF ID:TF_10_2
Super family:GARP
Sub family:ARR-B class
Gene name: putative two-component response regulator protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
>At2g25180
MTVEQNLEAL DQFPVGMRVL AVDDDQTCLK ILESLLRHCQ YHVTTTNQAQ KALELLRENK
NKFDLVISDV DMPDMDGFKL LELVGLEMDL PVIMLSAHSD PKYVMKGVTH GACDYLLKPV
RIEELKNIWQ HVVRSRFDKN RGSNNNGDKR DGSGNEGVGN SDPNNGKGNR KRKDQYNEDE
DEDRDDNDDS CAQKKQRVVW TVELHKKFVA AVNQLGYEKA MPKKILDLMN VEKLTRENVA
SHLQKFRLYL KRISGVANQQ AIMANSELHF MQMNGLDGFH HRPIPVGSGQ YHGGAPAMRS
FPPNGILGRL NSSSGIGVRS LSSPPAGMFL QNQTDIGKFH HVSSLPLNHS DGGNILQGLP
MPLEFDQLQT NNNKSRNMNS NKSIAGTSMA FPSFSTQQNS LISAPNNNVV VLEGHPQATP
PGFPGHQINK RLEHWSNAVS SSTHPPPPAH NSNSINHQFD VSPLPHSRPD PLEWNNVSSS
YSIPFCDSAN TLSSPALDTT NPRAFCRNTD FDSNTNVQPG VFYGPSTDAM ALLSSSNPKE
GFVVGQQKLQ SGGFMVADAG SLDDIVNSTM KQV
Length = 573 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_2
Sbjct: At2g25180

>At2g25180 putative two-component response regulator protein
          Length = 573

 Score =  112 bits (282), Expect = 3e-26
 Identities = 48/63 (76%), Positives = 58/63 (91%)

Query: 1   KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLG 60
           K RVVW+VELH++FVAAVNQLG EKA+PKKIL+LMNV  LTRENVASHLQK+R+YL+R+ 
Sbjct: 195 KQRVVWTVELHKKFVAAVNQLGYEKAMPKKILDLMNVEKLTRENVASHLQKFRLYLKRIS 254

Query: 61  GVS 63
           GV+
Sbjct: 255 GVA 257


InterPro Results:

IPR001005 Domain
PF00249 T[197-247] 8.4e-11 Myb_DNA-binding
Myb, DNA-binding
IPR001789 Domain
PD000039 T[17-125] 6e-53 sp_O49397_ARATH_O49397;
PF00072 T[17-136] 5.8e-27 Response_reg
SM00448 T[17-129] 2e-33 REC
PS50110 T[18-133] 32.957 RESPONSE_REGULATORY
Response regulator receiver
IPR006447 Domain
TIGR01557 T[195-250] 5e-30 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[191-254] 8e-21 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[16-134] 7.5e-33 CheY-like
CheY-like
NULL
seg ?[177-189]?[312-323]?[371-383] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_2 GARPARR-B class112 3e-26
TF_10_1 GARPG2-like112 9e-25
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 74 2e-13
TF_1_2 MYB superfamilyLHY 63 6e-10

TOP