AGI ID: At2g24700

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
>At2g24700
MANPLLYSPI NPQFFQPLLP GFTNHLDIPV AFFLKYLVGT NVGKTAELRS DASEMTWKVK
IDGRRLSNGW EDFTIAHDLR VGDIVVFRQE GELVFHVTAL GPSCCEIQYG EDTLEEDKIG
NLSFILNIIS TFRMSLRILL NLSTEKLCGT ENVSSKKKSL KREAESAPDN SLDSCFVATV
TGSNLKRDTL YIPKEFALSN GLMNKYQIVL MNEEGESWKI DLRREAYNYG RFYMRRGWRS
FCIANGKKPG DVFAFKLVKN EETPMIQLFP MTIEDLDKLQ SLPRHKIRKT EAAPSSPDLS
SFVATVTASN LSRDRLYLPK TFIMSNGLLK KFQMCLMNEE GESWTIDVKH EAHTGRFLTI
RGWRRFCVAN GKKPGDLLKF KLVHNEETPV LQLLPLNSED LHKLNPSNDT RHGQSLKVTK
KEFLGMEATE NEFLGEEVYC NDSFKASEKD TLPFAEPINE DIRQGQCSQT IKQEYVSTEE
KNSTSQNRFV TLTLTHSSKL NLPFEFMKRN GIKKAGKITM VDRYDAKWRT SLLMDKIGTM
SLGRGSKGFC ENIKINSSPL TTMLFNVSAC DIRDKPMPSN NDINKIDQLE RVKKVRKNSS
QSEAGSSSSG NSSFVALVKA SNLKEDALYL PQDCTSSNGL NKKCRKIFLT DGGDRSWEMD
LKFDKNLDSF CITRGWRHFC DENGKKYLSR RFLKNNGLGE PKMVTLVGTD GTRILANLLR
ESTGRMSLGR GWVDFAKANR LKIGEYFTLE SIWENDSPIL SLYGTNTSKS DKRKRRENFP
VACEKEYVST EARNRNEPEK DKNTEEMINQ ASLSENRLVI TLVPEDVKAG MLVFDITESR
SDEKIMELRF NEKIQNYGFG ENITESRFGE KISNHVFGSK IIESCFGGKI MESRFRREM
Length = 899 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At2g24700

>At2g24700 hypothetical protein
          Length = 899

 Score = 99.2 bits (246), Expect = 3e-21
 Identities = 19/111 (17%), Positives = 32/111 (28%), Gaps = 12/111 (10%)

Query: 82  IDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIP---IRMEDLDGFHV 138
                L   F   +  S++     + +PK+ A           G+      +   +    
Sbjct: 167 APDNSLDSCFVATVTGSNLKRDT-LYIPKEFA--------LSNGLMNKYQIVLMNEEGES 217

Query: 139 WTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQA 189
           W    R    N  R Y+      F  A+G + GD             +IQ 
Sbjct: 218 WKIDLRREAYNYGRFYMRRGWRSFCIANGKKPGDVFAFKLVKNEETPMIQL 268



 Score = 83.8 bits (206), Expect = 1e-16
 Identities = 17/111 (15%), Positives = 33/111 (29%), Gaps = 13/111 (11%)

Query: 82  IDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRM---EDLDGFHV 138
                    F   +  S++S   R+ LPK              G+  +       +    
Sbjct: 293 APSSPDLSSFVATVTASNLSRD-RLYLPKTFI--------MSNGLLKKFQMCLMNEEGES 343

Query: 139 WTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQA 189
           WT   ++  +    + +      F  A+G + GD +           V+Q 
Sbjct: 344 WTIDVKHEAHTGRFLTIR-GWRRFCVANGKKPGDLLKFKLVHNEETPVLQL 393



 Score = 53.7 bits (128), Expect = 1e-07
 Identities = 11/86 (12%), Positives = 25/86 (28%), Gaps = 6/86 (6%)

Query: 84  PRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKY 143
                  F   +K S++     + LP    +    +    +          G   W    
Sbjct: 607 SSSGNSSFVALVKASNLKEDA-LYLP----QDCTSSNGLNKKCRKIFLTDGGDRSWEMDL 661

Query: 144 RYWPNNNSRMYVLENTGDFVNAHGLQ 169
           ++  N +S   +      F + +G +
Sbjct: 662 KFDKNLDSFC-ITRGWRHFCDENGKK 686


InterPro Results:

IPR003340 Family
PF02362 T[13-105] 5.6e-28T[175-275] 1.2e-41T[301-400] 6e-40T[489-581] 0.0034T[671-769] 9.2e-27 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[55-142] 2e-12 Cupredoxins
Cupredoxin
NULL
seg ?[598-613] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3 99 3e-21
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 94 2e-19
TF_17_2 ARFNPH4/ARF7 92 3e-18

TOP