AGI ID: At2g24690

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
>At2g24690
MMIQFSNNHD NNIEFQRRKK MKKNNPETET DSSSDLSCFV AQTGALRLPM QFTRENGINK
PGKIYLVGKD GSKWLANLLL ENNRGRMTLG DGWKSFVKAN GLKTGDTYTF KLLWEDTTPV
LSLCFEEYNT DTRVGEESSK ESLPAEPSSQ EKIVKDDNNK DESSTWKREG NHLRCKDSTS
PSQNCTLTVT ITPDSLEHGR LRLPLQFMTE NSMNKPGEIT LLGTDGAKWM ASLLLEKKGR
MSLGKGWKDF AKANGLKTGD SITLEPIWED RTPVLSIKSS SGKGQSEFSK ESLSIKPSSG
NMTKKVENNR EASRKYPPRS RESSSAIQNQ FMALTPLRDI VSQVAHDLSI GEVINFRHKG
DNMLRVSDLG SNCCGVQDLL APSSNYDHDN IKPPSKKKVK KNNPEMEADY LSDHSCFVSH
VTTSSLHTNA LSLEVKESLP IEPSIKPNIS EDDNNKEEDI IEENSSFERE KNHWICIDSI
SSSQNRFLTL TITPDSLKHG RLRLPLQFMI ENSMNKPGEI TVLGKDGAKW LVSLLLERRG
RMSLDASSGQ ETREAEKNRE ESSSLWELEK RTYCPRKRDS SSDVKNRFLT LTLAPEDVKD
GNLHLPCQFM RINGINKPGQ ITLLGRGGMK WFAYLLSGDG TVVVGNGWKG FCEANGVMLG
ETFVLEFIPK DDTNHVFKFY TK
Length = 682 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At2g24690

>At2g24690 unknown protein
          Length = 682

 Score =  101 bits (253), Expect = 1e-21
 Identities = 29/169 (17%), Positives = 49/169 (28%), Gaps = 16/169 (9%)

Query: 534 TQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFL-LQKVLKQSDVGNLGRIVLPKKE 592
           +Q   +    +       +   +  +        +   L   +   D    GR+ LP + 
Sbjct: 149 SQEKIVKDDNNKDESSTWKREGNHLRCKDSTSPSQNCTLTVTITP-DSLEHGRLRLPLQF 207

Query: 593 AETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGD 652
               + E                   W          K RM L +   DF K NGL+ GD
Sbjct: 208 ----MTENSMNKPG-EITLLGTDGAKW--MASLLLEKKGRMSLGKGWKDFAKANGLKTGD 260

Query: 653 FIVI---YSDVKLIRGVKVRQPSGQKPEAPPSSAAT----KRQNKSQRN 694
            I +   + D   +  +K     GQ   +  S +          K + N
Sbjct: 261 SITLEPIWEDRTPVLSIKSSSGKGQSEFSKESLSIKPSSGNMTKKVENN 309



 Score = 69.2 bits (168), Expect = 8e-12
 Identities = 20/136 (14%), Positives = 36/136 (25%), Gaps = 17/136 (12%)

Query: 550 RQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLA 609
           R+++  +  +      +                 G + LP +            +     
Sbjct: 18  RKKMKKNNPETETDSSSDLSCFVAQ--------TGALRLPMQF-----TRENGINKPGKI 64

Query: 610 MEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVI---YSDVKLIRGV 666
                    W        N   RM L +    FVK NGL+ GD       + D   +  +
Sbjct: 65  YLVGKDGSKWLANLLLENNR-GRMTLGDGWKSFVKANGLKTGDTYTFKLLWEDTTPVLSL 123

Query: 667 KVRQPSGQKPEAPPSS 682
              + +        SS
Sbjct: 124 CFEEYNTDTRVGEESS 139



 Score = 61.1 bits (147), Expect = 2e-09
 Identities = 20/138 (14%), Positives = 40/138 (28%), Gaps = 13/138 (9%)

Query: 533 ETQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKE 592
           ET+    +R  S+S    ++     R+           L   L   DV   G + LP + 
Sbjct: 551 ETREAEKNREESSSLWELEKRTYCPRKRDSSSDVKNRFLTLTLAPEDV-KDGNLHLPCQF 609

Query: 593 AETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGD 652
                  +   +              W   + +  +    + +      F + NG+  G+
Sbjct: 610 MR-----INGINKPGQITLLGRGGMKW---FAYLLSGDGTVVVGNGWKGFCEANGVMLGE 661

Query: 653 FIVIYS----DVKLIRGV 666
             V+      D   +   
Sbjct: 662 TFVLEFIPKDDTNHVFKF 679


InterPro Results:

IPR003340 Family
PF02362 T[38-130] 7.5e-28T[186-284] 1.7e-28T[487-574] 4.4e-05T[588-680] 1.5e-18 B3
Transcriptional factor B3
NULL
seg ?[390-404]?[448-466] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3101 1e-21
TF_17_2 ARFNPH4/ARF7 98 3e-20
TF_22_1 ABI3/VP1FUSCA3 74 1e-13

TOP