AGI ID: At2g24680

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
>At2g24680
MAWNLAIITL VGKDGTKLEA TLRRENRGLM CLGNGWKDLS ISNGLKSGKS FTLELILENG
TPMLSLVSTQ STSHKSQKRE CSKHSEKESI SAVPSKGKKN RKARSNREER RDSSSAIQNR
FVTFTPEDIR DCILILPSQF IKANGINNLG EITLLGQNRM KWFAYLLSMS KDGSLALGSG
WKGICEANGV NTGEAFTLEY IDEQETAHKT SQCVGEDDAL WKVGLEMVLN SSDLGPSRCD
IRDLPAPSST NDQGKTELAR KKKVKRSNTE IEADASSSDN SCFVALVTAS NLRKDALVTV
CIFSNLYSNF SLVFISILFG ESVFSRLLYL CLYLPQDLTS SVGLERKYRE IVVTDERERR
SWALDLRFNK SSDTFYISRG WRSFCDENGK KPGGVFVFKL VGNRETPVLS FCSTESINDG
TQGHKNNKYN CMELKSKKKR MRCRDSTSPS QNRFMTLTLT HDNLIKSRRQ LPLPFMRENG
LVKPGIINLL GKDGTKWEVN LRREANGTMY LGKGWKDFTI ANGLKTGESF TLEAVLENGT
RMLSLVSTQS TSDRNQQGEC LKDSEKESNS TEPSSGKRKA MINRGVRRKS FPASQNRCVT
LKLTHDNLIK SRRYLPLSFT RDNGLDKPGM IFLLGKTGRK WEANLLREAS GRIVLTGKGW
KEFAMANGLK SGELFTLEAI LEKGTPMLSL VNTQSTNYRS QQGECSRDSE KESSICAEPS
RGNKKWKATN NRKERRDSSS AIQNRYVTLT LTPEDVRACT LILPSQFMKA NGINKLGKKT
LLGQNRKKWF AYLLSKSGFV ALGSGWKGFC EANGVKTGES FNLEYIDEQD TTPVFKFCSN
SVEYVKFTSL P
Length = 851 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At2g24680

>At2g24680 unknown protein
          Length = 851

 Score = 80.0 bits (196), Expect = 4e-15
 Identities = 13/133 (9%), Positives = 40/133 (29%), Gaps = 14/133 (10%)

Query: 543 GSASAMPRQQVVPDRRQGWKPEKNLRF-LLQKVLKQSDVGNLGRIVLPKKEAETHLPELE 601
             +    + +   +R++       ++   +   L   DV     ++LP +  + +     
Sbjct: 718 EPSRGNKKWKATNNRKERRDSSSAIQNRYVTLTLTPEDV-RACTLILPSQFMKAN----- 771

Query: 602 ARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYS--- 658
             + +          + W   + +  +    + L      F + NG++ G+   +     
Sbjct: 772 GINKLGKKTLLGQNRKKW---FAYLLSKSGFVALGSGWKGFCEANGVKTGESFNLEYIDE 828

Query: 659 -DVKLIRGVKVRQ 670
            D   +       
Sbjct: 829 QDTTPVFKFCSNS 841



 Score = 68.0 bits (165), Expect = 2e-11
 Identities = 22/151 (14%), Positives = 39/151 (25%), Gaps = 15/151 (9%)

Query: 544 SASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQS-DVGNLGRIVLPKKEAETHLPELEA 602
           +       +    R +        +      L  + D     R  LP      +      
Sbjct: 427 NKYNCMELKSKKKRMRCRDSTSPSQNRF-MTLTLTHDNLIKSRRQLPLPFMREN-----G 480

Query: 603 RDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIY---SD 659
                +          W +  R   N    MYL +   DF   NGL+ G+   +     +
Sbjct: 481 LVKPGIINLLGKDGTKWEVNLRREAN--GTMYLGKGWKDFTIANGLKTGESFTLEAVLEN 538

Query: 660 VKLIRGVKVRQPSG---QKPEAPPSSAATKR 687
              +  +   Q +    Q+ E    S     
Sbjct: 539 GTRMLSLVSTQSTSDRNQQGECLKDSEKESN 569



 Score = 64.5 bits (156), Expect = 2e-10
 Identities = 21/162 (12%), Positives = 43/162 (25%), Gaps = 16/162 (9%)

Query: 532 METQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKK 591
           ++      +    +S   +  +    R+   P    R  +   L   ++    R  LP  
Sbjct: 561 LKDSEKESNSTEPSSGKRKAMINRGVRRKSFPASQNR-CVTLKLTHDNLIK-SRRYLPLS 618

Query: 592 EAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLL-ENTGDFVKTNGLQE 650
               +                  T R W        +   R+ L  +   +F   NGL+ 
Sbjct: 619 FTRDN----GLDKPGM-IFLLGKTGRKWEANLLREAS--GRIVLTGKGWKEFAMANGLKS 671

Query: 651 GDFIVIY---SDVKLIRGV---KVRQPSGQKPEAPPSSAATK 686
           G+   +         +  +   +      Q+ E    S    
Sbjct: 672 GELFTLEAILEKGTPMLSLVNTQSTNYRSQQGECSRDSEKES 713



 Score = 60.7 bits (146), Expect = 3e-09
 Identities = 11/126 (8%), Positives = 33/126 (25%), Gaps = 8/126 (6%)

Query: 533 ETQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKE 592
           +        A  +     ++   +R +       ++          D+     ++LP + 
Sbjct: 83  KHSEKESISAVPSKGKKNRKARSNREERRDSSSAIQNRFV-TFTPEDI-RDCILILPSQF 140

Query: 593 AETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGD 652
            + +       + +            W   Y    +    + L        + NG+  G+
Sbjct: 141 IKAN-----GINNLGEITLLGQNRMKW-FAYLLSMSKDGSLALGSGWKGICEANGVNTGE 194

Query: 653 FIVIYS 658
              +  
Sbjct: 195 AFTLEY 200



 Score = 58.8 bits (141), Expect = 1e-08
 Identities = 17/177 (9%), Positives = 38/177 (20%), Gaps = 37/177 (20%)

Query: 534 TQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDV------------- 580
           +      +   A    + +      +      +       ++  S++             
Sbjct: 248 SSTNDQGKTELAR-KKKVKRSNTEIEADASSSDN-SCFVALVTASNLRKDALVTVCIFSN 305

Query: 581 --GNLGRIVLPKKEAETHLPELEA----------------RDGISLAMEDIGTSRVWNMR 622
              N   + +     E+    L                  R    + + D    R W + 
Sbjct: 306 LYSNFSLVFISILFGESVFSRLLYLCLYLPQDLTSSVGLERKYREIVVTDERERRSWALD 365

Query: 623 YRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVK---LIRGVKVRQPSGQKP 676
            RF   +    Y+      F   NG + G   V          +      +      
Sbjct: 366 LRF-NKSSDTFYISRGWRSFCDENGKKPGGVFVFKLVGNRETPVLSFCSTESINDGT 421


InterPro Results:

IPR003340 Family
PF02362 T[1-73] 0.0016T[120-219] 2.1e-25T[317-418] 5.1e-35T[454-552] 2.8e-36T[598-697] 2e-32T[746-844] 1.8e-32 B3
Transcriptional factor B3
NULL
seg ?[104-115]?[327-334] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 80 4e-15
TF_17_2 ARFNPH4/ARF7 80 1e-14
TF_22_1 ABI3/VP1FUSCA3 67 2e-11

TOP