AGI ID: At2g24670

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
>At2g24670
MIFKKEVSKE DVECVETLLM MSNSKPTREE YNKLQLCILR RNKSSTITTP STVMESKSHI
HDHSLRESPT RRSRNRHDLP PMSPPMEQRK SKKAKRSTDA SSSKTREPTP GWLISLMRSK
NGGDVEDNSK KIIDKELFQT DVDPHQSRLS IPVSQIVELE FLNHEEKRAI EEDANRVRKE
GVDAILVDSH LREFPVNLRL RDMRGILLYN LVAGWNQVVT DCLLEENTNI RLWSFHADDT
LYFALVPLYA N
Length = 251 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At2g24670

>At2g24670 hypothetical protein
          Length = 251

 Score =  125 bits (313), Expect = 2e-28
 Identities = 26/189 (13%), Positives = 47/189 (24%), Gaps = 22/189 (11%)

Query: 53  QVAASMQKQTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLA 112
              +  +  T    +  +LP     M    +  A   TD      +     +     L++
Sbjct: 61  HDHSLRESPTRRSRNRHDLPPMSPPMEQRKSKKAKRSTD-----ASSSKTREPTPGWLIS 115

Query: 113 SDMGLKL---NRQPNEFFCKTLTASDTSTH-GGFSVP---------RRAAEKIFPALDFS 159
                          +   K L  +D   H    S+P             EK     D +
Sbjct: 116 LMRSKNGGDVEDNSKKIIDKELFQTDVDPHQSRLSIPVSQIVELEFLNHEEKRAIEEDAN 175

Query: 160 MQPP-CQELVAKDIHDNTWTFRHIYRGQPK--RHLLTTGWSVFVSTKRLFAGDSVLFIRD 216
                  + +  D H   +      R       + L  GW+  V+   L    ++     
Sbjct: 176 RVRKEGVDAILVDSHLREFPVNLRLRDMRGILLYNLVAGWNQVVTDCLLEENTNIRLWSF 235

Query: 217 GKAQ-LLLG 224
                L   
Sbjct: 236 HADDTLYFA 244


InterPro Results:

IPR005508 Domain
PF03754 T[107-221] 1.5e-65 DUF313
Protein of unknown function DUF313

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7125 2e-28
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 85 2e-16
TF_22_1 ABI3/VP1FUSCA3 73 2e-13

TOP