AGI ID: At2g24650

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201
1261
1321
1381
>At2g24650
MANSRIYPQF FHTLVPSFHT HLMIPEDFFS EYIEGRSVAE LKLDFSDKSW EVKLSDRRIT
DGWEEFVVAN DFRIGDVVAF RYVGNLVFHV SNLGPNYYEI EHNDELPKEK KAKTNSEEAD
AVSSSSSADK SCFMAIITAL DLTTDTLYLP LHFTSANGLT RKNREIILTD GGERSRVLDL
RFDESSGTFY ISRGWRNFCD ENGQKAGGFF LFKLVGKGET LVLSFCPTES INGEENITRE
DSKDECSSLD SLMNIVEKKK YIPKPRGSPY SSYSPSHKQF VTFTLPPDYA RIGKLSLSAP
FVRENGINKP GEICLLDKHG RKWLTSLLLD SKGTMSLGKG WKEFVKANSL ETGFTLKLIW
EETTPVLSLC SPESNSDREQ EEISKAIEKH SLFIDPSNRD KISNNDKEEN MSWERKKDHL
KSRDSTLSSQ KQFVTITITP SSDRLVSLSN DSCLVVVSLL YFDMRLPKVF TRENGINKPG
RITLLGKDGI KQQTNLLFDK ANGAMSLGHG WKDFVKDNGL KTGDSFTLKL IWEDQTPVLS
LCPADCSIDR EAGGGRSETN QKKSLPIEPS TCKKIRKDVN IKDDNSKEKN DKEESKSVDG
ERKYLRGTYL TPSSQKHFVT LTITPSSIKK DRLILSPQFA RKNNIDKPGM IYLLDTDGTK
WLISLQRDKK GTMSLGKGWK EFAEANDFKL GESFTMELVW EDTTPMLSLL RTEFRSSKAN
EKESISSEHK TRESSPTIKN RIVTPALTPE DVKACKLVTS SNYSCFSEIL SAQFARENNI
NQPGTIYLLD TDGRKWLTTV KRDKKGTMSL GKGWKEFADT KDLKSGDSFT MELIWEDTNP
VLSLLRTKFS SSKSNKEESI FLEPKSRDSS SPTIVNRFVT LALTPEDVTA CKLILPSQFM
KANGINNKLG KITLLGENGV EWPGYMLSLD GTLALGNGWE GFCEANGVKL GQTFTLEFVN
EQDTTTTPRI PVAFFLKNIE GRYEQKTAEL RSDASKITWE VKIDGQRLTD GWKEFALSHD
LRIGDIVVFR QERDMSFHVT MLGPSCCEIQ YGSCSDEERN LEKKKNPNGE AKSSSLDPSC
FSANVAPSSL RYDLMLFPMG FVRENGVVGS GKIVLMNEKG RSWNFNLRQK PSCGTVYVRG
GWVSFCDANG LQAGDIYTFK LIKRGGTLVL RLLPKGAESC SLDPSCFVAN VAPSTLRYDT
LYLPKRFMRE NGVDKRRGEM ILMNEKGKSW TLDLKLKKSC GTSLIRRGWR SFCSANGLRA
GSIITFKLIK KSGTLVLCLL SNEPEEEVCS EANEVESLST DQESHEESSH NEKISRRKEK
KGRMIWKASS SPSENRFVTL NLTPYNILRS ALRLPIPFTR MNGINEETKM TLLDKHGMKW
LTTLRLVDYK RKRLGMVGGW KGFIQANGVK ANESIMLELI WEEETSCVLK FCSKVKLAIK
Length = 1440 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At2g24650

>At2g24650 hypothetical protein
          Length = 1440

 Score = 98.4 bits (244), Expect = 4e-21
 Identities = 15/105 (14%), Positives = 30/105 (28%), Gaps = 6/105 (5%)

Query: 87   LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYRYW 146
                F   +  S +     + LPK      +      +     +   +    WT   +  
Sbjct: 1183 DPSCFVANVAPSTLRYDT-LYLPK----RFMRENGVDKRRGEMILMNEKGKSWTLDLKLK 1237

Query: 147  PNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARK 191
             +  +   +      F +A+GL+ G  I       S   V+    
Sbjct: 1238 KSCGT-SLIRRGWRSFCSANGLRAGSIITFKLIKKSGTLVLCLLS 1281



 Score = 89.9 bits (222), Expect = 2e-18
 Identities = 18/113 (15%), Positives = 32/113 (27%), Gaps = 8/113 (7%)

Query: 78   PARKIDPRK-LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGF 136
            P  +          F   +  S +     +          +       G    +   +  
Sbjct: 1067 PNGEAKSSSLDPSCFSANVAPSSLRYDLML-----FPMGFVRENGVV-GSGKIVLMNEKG 1120

Query: 137  HVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQA 189
              W F  R  P+  + +YV      F +A+GLQ GD             V++ 
Sbjct: 1121 RSWNFNLRQKPSCGT-VYVRGGWVSFCDANGLQAGDIYTFKLIKRGGTLVLRL 1172



 Score = 70.3 bits (171), Expect = 1e-12
 Identities = 13/108 (12%), Positives = 31/108 (28%), Gaps = 6/108 (5%)

Query: 84  PRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKY 143
               +  F   +   D+++   + LP         A          +    G        
Sbjct: 126 SSADKSCFMAIITALDLTTDT-LYLP----LHFTSANGLTRKNREIILTDGGERSRVLDL 180

Query: 144 RYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARK 191
           R+  ++ +  Y+     +F + +G + G F +          V+    
Sbjct: 181 RFDESSGTF-YISRGWRNFCDENGQKAGGFFLFKLVGKGETLVLSFCP 227



 Score = 63.0 bits (152), Expect = 2e-10
 Identities = 20/123 (16%), Positives = 34/123 (27%), Gaps = 21/123 (17%)

Query: 85  RKLRFLFQKELKNS-----DVSSLRRMI----------LPKKAAEAHLPALECKEGIPIR 129
              +      +  S      +S+   ++          LPK             +   I 
Sbjct: 428 SSQKQFVTITITPSSDRLVSLSNDSCLVVVSLLYFDMRLPKVFT----RENGINKPGRIT 483

Query: 130 MEDLDGFHVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQA 189
           +   DG    T    +   N   M +     DFV  +GL+ GD   +         V+  
Sbjct: 484 LLGKDGIKQQT-NLLFDKAN-GAMSLGHGWKDFVKDNGLKTGDSFTLKLIWEDQTPVLSL 541

Query: 190 RKA 192
             A
Sbjct: 542 CPA 544



 Score = 58.4 bits (140), Expect = 5e-09
 Identities = 16/108 (14%), Positives = 34/108 (30%), Gaps = 8/108 (7%)

Query: 84  PRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKY 143
           P   +      +  S +    R+IL  + A          +   I + D DG   W    
Sbjct: 612 PSSQKHFVTLTITPSSIKKD-RLILSPQFA----RKNNIDKPGMIYLLDTDGTK-WLISL 665

Query: 144 RYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARK 191
               +    M + +   +F  A+  +LG+   +         ++   +
Sbjct: 666 --QRDKKGTMSLGKGWKEFAEANDFKLGESFTMELVWEDTTPMLSLLR 711



 Score = 50.3 bits (119), Expect = 1e-06
 Identities = 16/100 (16%), Positives = 31/100 (31%), Gaps = 9/100 (9%)

Query: 81   KIDPRKLRFLF-QKELKNSDVSSLR-RMILPKKAAEAHLPALECKEGIPIRMEDLDGFHV 138
            K         F    L   ++     R+ +P              E   + + D  G   
Sbjct: 1327 KASSSPSENRFVTLNLTPYNILRSALRLPIP------FTRMNGINEETKMTLLDKHGMK- 1379

Query: 139  WTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQ 178
            W    R       R+ ++     F+ A+G++  + IM+  
Sbjct: 1380 WLTTLRLVDYKRKRLGMVGGWKGFIQANGVKANESIMLEL 1419



 Score = 49.1 bits (116), Expect = 3e-06
 Identities = 14/109 (12%), Positives = 29/109 (25%), Gaps = 10/109 (9%)

Query: 84  PRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKY 143
               +      L   D + + ++ L               +   I + D  G   W    
Sbjct: 274 SPSHKQFVTFTLPP-DYARIGKLSLSAPFV----RENGINKPGEICLLDKHG-RKWLTSL 327

Query: 144 RYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKA 192
                +   M + +   +FV A+ L+ G    +         V+     
Sbjct: 328 LLD--SKGTMSLGKGWKEFVKANSLETG--FTLKLIWEETTPVLSLCSP 372



 Score = 44.1 bits (103), Expect = 1e-04
 Identities = 17/120 (14%), Positives = 35/120 (29%), Gaps = 11/120 (9%)

Query: 79  ARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKA-------AEAHLPALECKEGIPIRME 131
            R+  P     +    L   DV +  +++            +          +   I + 
Sbjct: 731 TRESSPTIKNRIVTPALTPEDVKA-CKLVTSSNYSCFSEILSAQFARENNINQPGTIYLL 789

Query: 132 DLDGFHVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARK 191
           D DG   W    +        M + +   +F +   L+ GD   +       N V+   +
Sbjct: 790 DTDG-RKWLTTVKRD--KKGTMSLGKGWKEFADTKDLKSGDSFTMELIWEDTNPVLSLLR 846


InterPro Results:

IPR003340 Family
PF02362 T[9-98] 1.3e-24T[132-232] 7.3e-38T[280-376] 1.6e-35T[449-548] 2.1e-31T[618-716] 1.7e-39T[753-851] 1.2e-33T[878-962] 5e-16T[963-1047] 4.8e-14T[1080-1179] 5.4e-43T[1186-1286] 7.6e-42T[1337-1438] 6.1e-26 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[39-96] 0.00059T[997-1052] 7.5e-07 Cupredoxins
Cupredoxin
NULL
seg ?[116-131]?[135-149]?[207-218]?[268-276]?[580-597]?[850-859]?[1281-1297] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3 98 4e-21
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 87 4e-17
TF_17_2 ARFNPH4/ARF7 87 6e-17

TOP