AGI ID: At2g21920

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
>At2g21920
MSFDVRSEKI DLIKGPELPD YNMFMSQKFT SYEGKLAILL TGNGDCSFYM WILEDAAKHE
WSKKAYVVPD FFPLDPFVLL MQRANENDIV RTFHYDDRVG TSDAIVESTP ASPPRHIMFS
VIIRKDSPLR NLRGAKSIFK VSFTIILKTF IVKLIMMKDF QLDGDMIISK TLSRTDVDHH
GRLFLPKNQV LSVLKKMRNV TKESLRKGIE LEVVDIIEND SYSVILKSRN TTNDFVLASG
WSIMKHSLDL QEGDDIKLFW DYLNYKFIIL NFEYNLIP
Length = 278 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At2g21920

>At2g21920 hypothetical protein
          Length = 278

 Score = 95.7 bits (237), Expect = 1e-19
 Identities = 20/96 (20%), Positives = 37/96 (37%), Gaps = 4/96 (4%)

Query: 125 EFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQ---PPCQELVAKD-IHDNTWTFR 180
               KTL+ +D   HG   +P+     +   +    +       EL   D I +++++  
Sbjct: 166 MIISKTLSRTDVDHHGRLFLPKNQVLSVLKKMRNVTKESLRKGIELEVVDIIENDSYSVI 225

Query: 181 HIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRD 216
              R      +L +GWS+   +  L  GD +    D
Sbjct: 226 LKSRNTTNDFVLASGWSIMKHSLDLQEGDDIKLFWD 261


Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7 96 1e-19
TF_22_1 ABI3/VP1FUSCA3 92 4e-19
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 78 2e-14

TOP