AGI ID: At2g20570

TF ID:TF_10_2
Super family:GARP
Sub family:ARR-B class
Gene name: GPRI1 protein (gpri1)

Amino Acid Sequence:


1
61
121
181
241
301
361
>At2g20570
MLALSPATRD GCDGASEFLD TSCGFTIINP EEEEEFPDFA DHGDLLDIID FDDIFGVAGD
VLPDLEIDPE ILSGDFSNHM NASSTITTTS DKTDSQGETT KGSSGKGEEV VSKRDDVAAE
TVTYDGDSDR KRKYSSSASS KNNRISNNEG KRKVKVDWTP ELHRRFVEAV EQLGVDKAVP
SRILELMGVH CLTRHNVASH LQKYRSHRKH LLAREAEAAN WTRKRHIYGV DTGANLNGRT
KNGWLAPAPT LGFPPPPPVA VAPPPVHHHH FRPLHVWGHP TVDQSIMPHV WPKHLPPPST
AMPNPPFWVS DSPYWHPMHN GTTPYLPTVA TRFRAPPVAG IPHALPPHHT MYKPNLGFGG
ARPPVDLHPS KESVDAAIGD VLTRPWLPLP LGLNPPAVDG VMTELHRHGV SEVPPTASCA
Length = 420 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_2
Sbjct: At2g20570

>At2g20570 GPRI1 protein (gpri1)
          Length = 420

 Score =  103 bits (258), Expect = 2e-23
 Identities = 38/59 (64%), Positives = 46/59 (77%)

Query: 1   KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRL 59
           K +V W+ ELH++FV AV QLGV+KAVP +ILELM V  LTR NVASHLQKYR + + L
Sbjct: 153 KVKVDWTPELHRRFVEAVEQLGVDKAVPSRILELMGVHCLTRHNVASHLQKYRSHRKHL 211


InterPro Results:

IPR001005 Domain
PF00249 T[155-205] 8.8e-13 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[153-208] 1.1e-35 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[149-211] 5.3e-19 Homeodomain-like
Homeodomain-like
NULL
seg ?[31-35]?[44-55]?[83-95]?[125-147]?[246-276]?[385-396] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_2 GARPARR-B class103 2e-23
TF_10_1 GARPG2-like105 9e-23
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 75 1e-13
TF_1_2 MYB superfamilyLHY 75 1e-13

TOP