AGI ID: At2g20400

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At2g20400
MIPNDDDDAN SMKNYPLNDD DANSMKNYPL NDDDANSMEN YPLRSIPTEL SHTCSLIPPS
LPNPSEAAAD MSFNSELNQI MARPCDMLPA NGGAVGHNPF LEPGFNCPET TDWIPSPLPH
IYFPSGSPNL IMEDGVIDEI HKQSDLPLWY DDLITTDEDP LMSSILGDLL LDTNFNSASK
VQQPSMQSQI QQPQAVLQQP SSCVELRPLD RTVSSNSNNN SNSNNAAAAA KGRMRWTPEL
HEVFVDAVNQ LGGSNEATPK GVLKHMKVEG LTIFHVKSHL QKYRTAKYIP VPSEGSPEAR
LTPLEQITSD DTKRGIDITE TLRIQMEHQK KLHEQLESLR TMQLRIEEQG KALLMMIEKQ
NMGFGGPEQG EKTSAKTPEN GSEESESPRP KRPRNEE
Length = 397 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At2g20400

>At2g20400 unknown protein
          Length = 397

 Score =  115 bits (288), Expect = 9e-26
 Identities = 42/68 (61%), Positives = 51/68 (74%)

Query: 179 QRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQK 238
              A   AK R+RWTPELH  FV+AVN LGG ++ATPKG+LK M V+GLTI+H+KSHLQK
Sbjct: 223 SNNAAAAAKGRMRWTPELHEVFVDAVNQLGGSNEATPKGVLKHMKVEGLTIFHVKSHLQK 282

Query: 239 YRLNIRLP 246
           YR    +P
Sbjct: 283 YRTAKYIP 290



 Score = 84.3 bits (207), Expect = 3e-16
 Identities = 20/46 (43%), Positives = 32/46 (69%)

Query: 384 NLEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEGL 429
           ++ E L  QME QKKLHEQLE+ R +QL +E  G+ +  ++E++ +
Sbjct: 317 DITETLRIQMEHQKKLHEQLESLRTMQLRIEEQGKALLMMIEKQNM 362


InterPro Results:

IPR001005 Domain
PF00249 T[233-284] 2.5e-11 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[231-287] 5.5e-29 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[227-288] 1.1e-18 Homeodomain-like
Homeodomain-like
NULL
seg ?[182-199]?[214-230] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like115 9e-26
TF_10_2 GARPARR-B class 99 3e-22
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 67 3e-11
TF_1_2 MYB superfamilyLHY 63 5e-10

TOP