AGI ID: At2g18810

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
>At2g18810
MVRAFAYEEI GETSTEAHAS VEDNKRDRTR RVINYNLRST TMISSLSKRL KIDECKNQDP
EQNPNRVASS PSLCHVKSKR PQKGVSNKPI LDMDFLNEEE LEKIDRHYKK ISDSDKGADV
ILVNSEGLQR KLKLKRWDMT STSNYVLGSG WNKVVTENIL ETGTRLRLWS FHSPDMLFFA
LVLSDPDLAP TKDWECLNLL AKLTVETACL EASQDADTMS SLVSDTELDL ELRL
Length = 234 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At2g18810

>At2g18810 hypothetical protein
          Length = 234

 Score = 71.1 bits (173), Expect = 7e-13
 Identities = 10/70 (14%), Positives = 25/70 (35%), Gaps = 2/70 (2%)

Query: 121 ECKEGIPIRMEDLDGFHVWTFKYRYWPNNNSRMYVLE-NTGDFVNAHGLQLGDFIMVYQD 179
           +  +G  + + + +G      K + W   ++  YVL       V  + L+ G  + ++  
Sbjct: 113 DSDKGADVILVNSEGLQR-KLKLKRWDMTSTSNYVLGSGWNKVVTENILETGTRLRLWSF 171

Query: 180 LYSNNYVIQA 189
              +      
Sbjct: 172 HSPDMLFFAL 181


InterPro Results:

IPR005508 Domain
PF03754 T[40-157] 4.8e-55 DUF313
Protein of unknown function DUF313

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3 71 7e-13
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 71 2e-12
TF_17_2 ARFNPH4/ARF7 70 8e-12

TOP