AGI ID: At2g16210

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
>At2g16210
MATNAGYLRC KEERKNESFF KVVQSINVSS ENKRALPHDF SRSFTDKELS RKMKIRAQWG
NSWEVGISKN PRFYFMEKSG WEKFVRDNAL GNSELLTFTH KGKMHFTVNI FKLDGKEMMQ
PPQSRSFFAS SKQEENDIKE EVVVSSNRGQ TTAAESKGRK LNLGKRAAKE SQSSKRTEKV
VRARSDYAGA SSSTAAAFTI LFKQGYLVFL RIPNSVSKDQ VPDEKTVFKI HHPNGKKSWN
VVYLERFGAF SGGWRRVVKE YPLAVGDTCK FTFIKPKELL LVVSKP
Length = 286 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At2g16210

>At2g16210 hypothetical protein
          Length = 286

 Score = 88.8 bits (219), Expect = 9e-18
 Identities = 21/140 (15%), Positives = 44/140 (31%), Gaps = 17/140 (12%)

Query: 564 EKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRY 623
           E+       KV++  +V +  +  LP   + +   +  +R     A         W +  
Sbjct: 12  EERKNESFFKVVQSINVSSENKRALPHDFSRSFTDKELSRKMKIRA----QWGNSWEVGI 67

Query: 624 RFWPNNKSRMYLLE-NTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQPSGQKPEA--PP 680
                N    ++ +     FV+ N L   + +      K      V        E   PP
Sbjct: 68  SK---NPRFYFMEKSGWEKFVRDNALGNSELLTFT--HKGKMHFTVNIFKLDGKEMMQPP 122

Query: 681 SS-----AATKRQNKSQRNI 695
            S     ++ + +N  +  +
Sbjct: 123 QSRSFFASSKQEENDIKEEV 142



 Score = 42.6 bits (99), Expect = 8e-04
 Identities = 21/129 (16%), Positives = 38/129 (29%), Gaps = 12/129 (9%)

Query: 543 GSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEA 602
            S S+   ++VV  R        +       + KQ   G L  + +P   ++  +P    
Sbjct: 170 ESQSSKRTEKVVRARSDYAGASSSTAAAFTILFKQ---GYLVFLRIPNSVSKDQVP---- 222

Query: 603 RDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKL 662
            +     +      + WN+ Y      +            VK   L  GD          
Sbjct: 223 DEKTVFKIHHPNGKKSWNVVYL-----ERFGAFSGGWRRVVKEYPLAVGDTCKFTFIKPK 277

Query: 663 IRGVKVRQP 671
              + V +P
Sbjct: 278 ELLLVVSKP 286


InterPro Results:

IPR003340 Family
PF02362 T[18-116] 8.3e-05T[197-286] 0.00048 B3
Transcriptional factor B3
NULL
seg ?[188-197] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 89 9e-18
TF_22_1 ABI3/VP1FUSCA3 66 2e-11

TOP