AGI ID: At2g06020

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At2g06020
MKKQEKGNEV VTFEENPSTY VHHHTKKASM VLSEQEIEVI LQSNKETYNE KLEKNTKENA
EKVGIEEGNG SSSKITPCIF YTSDEKARLR WSSDLHDCFV NAVEKLGGPN KATPKSVKEA
MEVEGIALHH VKSHLQKFRL GKCNIRGGTN QYVRQSQSMP HKSQQQLQLN NDCVNHDSYC
NATFLSVTVP PTIDSLHQDT LNNTILFPTT LQAIPTSVSH NTYMSSYPSY NTVEVVKAQL
NALQDSSTSQ TQETFSRETN LSSIVTRDEA DPVDKYIDWN KVGETDIEHD SVEVLEALGL
K
Length = 301 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At2g06020

>At2g06020 hypothetical protein
          Length = 301

 Score =  103 bits (257), Expect = 4e-22
 Identities = 34/62 (54%), Positives = 47/62 (74%)

Query: 182 ATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRL 241
            T   K+RLRW+ +LH+ FVNAV  LGGP+KATPK + + M V+G+ ++H+KSHLQK+RL
Sbjct: 81  YTSDEKARLRWSSDLHDCFVNAVEKLGGPNKATPKSVKEAMEVEGIALHHVKSHLQKFRL 140

Query: 242 NI 243
             
Sbjct: 141 GK 142


InterPro Results:

IPR001005 Domain
PF00249 T[88-139] 3.5e-09 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[86-142] 3e-35 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[82-146] 2.4e-16 Homeodomain-like
Homeodomain-like

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like103 4e-22
TF_10_2 GARPARR-B class 87 2e-18
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 73 4e-13
TF_1_2 MYB superfamilyLHY 61 2e-09

TOP