AGI ID: At2g03500

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
>At2g03500
MASSSELSLD CKPQSYSMLL KSFGDNFQSD PTTHKLEDLL SRLEQERLKI DAFKRELPLC
MQLLNNAVEV YKQQLEAYRA NSNNNNQSVG TRPVLEEFIP LRNQPEKTNN KGSNWMTTAQ
LWSQSETKPK NIDSTTDQSL PKDEINSSPK LGHFDAKQRN GSGAFLPFSK EQSLPELALS
TEVKRVSPTN EHTNGQDGND ESMINNDNNY NNNNNNNSNS NGVSSTTSQS NRKARRCWSP
DLHRRFVQAL QMLGGSQVAT PKQIRELMKV DGLTNDEVKS HLQKYRLHTR RPSPSPQTSG
GPGPHLVVLG GIWVPPEYTS AHGGTPTLYH HQVHHHHTNT AGPPPPHFCS SQEFYTTPPP
PQPLHHHHFQ TFNGSSGGTA STDSTHHQVT DSPTVEGKSP ESGGGERKGL AALREECEDH
SNINGSEITL KF
Length = 432 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At2g03500

>At2g03500 unknown protein
          Length = 432

 Score =  119 bits (299), Expect = 5e-27
 Identities = 36/69 (52%), Positives = 44/69 (63%)

Query: 178 PQRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQ 237
               +    K+R  W+P+LH RFV A+  LGG   ATPK I +LM VDGLT   +KSHLQ
Sbjct: 224 SSTTSQSNRKARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQ 283

Query: 238 KYRLNIRLP 246
           KYRL+ R P
Sbjct: 284 KYRLHTRRP 292


InterPro Results:

IPR001005 Domain
PF00249 T[235-286] 6.4e-11 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[233-289] 4.1e-35 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[229-293] 2.2e-18 Homeodomain-like
Homeodomain-like
NULL
coil ?[36-57]?[61-82] coiled-coil
seg ?[199-231]?[292-311]?[330-337]?[358-368]?[374-385] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like119 5e-27
TF_10_2 GARPARR-B class106 2e-24
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 82 1e-15
TF_1_2 MYB superfamilyLHY 64 3e-10

TOP