AGI ID: At2g02060

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At2g02060
MGKSSGRNGN GSFNGNKFHG VRPYVRSPVP RLRWTPDLHR CFVHAVEILG GQHRATPKLV
LKMMDVKGLT ISHVKSHLQM YRGGSKLTLE KPEESSSSSI RRRQDSEEDY YLHDNLSLHT
RNDCLLGFHS FPLSSHSSFR GGGGGRTKEQ QTSESGGYDD DADFLHIKKM NDTTTFLSHH
FPKGTEEWRE QEHEEEEEDL SLSLSLNHHH WRSNGSSVMN LSNRFGSNSK TAILNDSYSD
ENHSSSAAAA VTSVVIPPCS GNVLRAVLLL FFICFCFSLY RTSGYLRIVS DSSSTLSRIF
PSVNDSSSSP SPSPSLSPEE IEEPKLEEVL RRAATKDGTV ILTTLNEAWA APGSVIDLFF
ESFRIGKGTR RLLKHLVIIA LDAKAYSRCQ ELHKHCFRLE TEGVDFSGGE AYFMTPSYLT
MMWRRISFLR SVLEKGYNFV FTDADVMWFR NPFRRFYEDG DFQIACDHYI GRPNDFRNRP
NGGFTFVRAN NRSIGFYKFW YDSRTKYPKN HDQDVLNFIK TDPFLWKLRI RIRFLNTVYF
GGFCEPSKDL NLVCTMHANC CFGLDSKLHD LRIMLQDWRD FKSLPLHSNQ SSGFTWSVPQ
NCSLDSLRPV DSKDEEESEP PGESTQ
Length = 626 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At2g02060

>At2g02060 unknown protein
          Length = 626

 Score =  107 bits (266), Expect = 3e-23
 Identities = 36/61 (59%), Positives = 42/61 (68%)

Query: 180 RAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKY 239
           R        RLRWTP+LH  FV+AV  LGG  +ATPK +LK+M V GLTI H+KSHLQ Y
Sbjct: 22  RPYVRSPVPRLRWTPDLHRCFVHAVEILGGQHRATPKLVLKMMDVKGLTISHVKSHLQMY 81

Query: 240 R 240
           R
Sbjct: 82  R 82


InterPro Results:

IPR001005 Domain
PF00249 T[31-82] 1e-11 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[30-85] 1e-25 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[25-88] 4.8e-17 Homeodomain-like
Homeodomain-like
NULL
seg ?[2-20]?[93-108]?[125-139]?[140-146]?[186-214]?[244-255]?[268-279]?[306-328] seg
SSF51445 T[280-545] 7e-27 (Trans)glycosidases
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like107 3e-23
TF_10_2 GARPARR-B class 95 8e-21
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 71 2e-12
TF_1_2 MYB superfamilyLHY 71 2e-12

TOP