AGI ID: At2g01760

TF ID:TF_10_2
Super family:GARP
Sub family:ARR-B class
Gene name: putative two-component response regulator protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At2g01760
MPINDQFPSG LRILVVDDDT SCLFILEKML LRLMYQVTIC SQADVALTIL RERKDSFDLV
LSDVHMPGMN GYNLLQQVGL LEMDLPVIMM SVDGRTTTVM TGINHGACDY LIKPIRPEEL
KNIWQHVVRR KCVMKKELRS SQALEDNKNS GSLETVVVSV SECSEESLMK CRNKKKKKKR
SVDRDDNEDD LLLDPGNSKK SRVVWSIELH QQFVNAVNKL GIDKAVPKRI LELMNVPGLS
RENVASHLQK FRLYLKRLSG EASQSNDSES TKRYENIQAL VSSGQLHPQT LAALFGQPID
NHHSASFGVW IPNDNLGRSQ NEHFSVDVSS ASNRPVSVAV HGLSSSANFR QRGDVNNNRI
RQGYGSNVNE ESWILERSSR QR
Length = 382 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_2
Sbjct: At2g01760

>At2g01760 putative two-component response regulator protein
          Length = 382

 Score =  108 bits (271), Expect = 5e-25
 Identities = 49/61 (80%), Positives = 58/61 (94%)

Query: 1   KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLG 60
           K RVVWS+ELHQQFV AVN+LG++KAVPK+ILELMNVPGL+RENVASHLQK+R+YL+RL 
Sbjct: 200 KSRVVWSIELHQQFVNAVNKLGIDKAVPKRILELMNVPGLSRENVASHLQKFRLYLKRLS 259

Query: 61  G 61
           G
Sbjct: 260 G 260


InterPro Results:

IPR001005 Domain
PF00249 T[202-252] 5e-11 Myb_DNA-binding
Myb, DNA-binding
IPR001789 Domain
PD000039 T[12-120] 3e-56 sp_Q9ZUA4_ARATH_Q9ZUA4;
PF00072 T[11-132] 2.3e-22 Response_reg
SM00448 T[11-124] 3.5e-28 REC
PS50110 T[12-128] 31.234 RESPONSE_REGULATORY
Response regulator receiver
IPR006447 Domain
TIGR01557 T[200-255] 2e-31 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[196-259] 2.4e-20 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[8-146] 4.3e-33 CheY-like
CheY-like
NULL
seg ?[150-167]?[174-179]?[183-194] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_2 GARPARR-B class108 5e-25
TF_10_1 GARPG2-like108 9e-24
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 77 2e-14
TF_1_2 MYB superfamilyLHY 68 1e-11

TOP