AGI ID: At2g01060

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: transfactor-like protein

Amino Acid Sequence:


1
61
121
181
241
>At2g01060
MEADNGGPNS SHASKQRLRW THELHERFVD AVAQLGGPDR ATPKGVLRVM GVQGLTIYHV
KSHLQKYRLA KYLPDSSSEG KKTDKKESGD MLSGLDGSSG MQITEALKLQ MEVQKRLHEQ
LEVQRQLQLR IEAQGKYLKK IIEEQQRLSG VLGEPSAPVT GDSDPATPAP TSESPLQDKS
GKDCGPDKSL SVDESLSSYR EPLTPDSGCN IGSPDESTGE ERLSKKPRLV RGAAGYTPDI
VVGHPILESG LNTSYHQSDH VLAFDQPSTS LLGAEEQLDK VSGDNL
Length = 286 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At2g01060

>At2g01060 transfactor-like protein
          Length = 286

 Score =  123 bits (309), Expect = 4e-28
 Identities = 45/67 (67%), Positives = 54/67 (80%)

Query: 180 RAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKY 239
             ++  +K RLRWT ELH RFV+AV  LGGPD+ATPKG+L++MGV GLTIYH+KSHLQKY
Sbjct: 8   PNSSHASKQRLRWTHELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKY 67

Query: 240 RLNIRLP 246
           RL   LP
Sbjct: 68  RLAKYLP 74



 Score = 99.3 bits (246), Expect = 7e-21
 Identities = 29/54 (53%), Positives = 40/54 (73%), Gaps = 1/54 (1%)

Query: 385 LEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEG-LTSRLPELS 437
           + EAL  QME+QK+LHEQLE QRQLQL +EA G+Y+  ++E++  L+  L E S
Sbjct: 103 ITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLGEPS 156


InterPro Results:

IPR001005 Domain
PF00249 T[17-68] 1.1e-11 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[15-71] 1.2e-32 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[11-75] 1.4e-18 Homeodomain-like
Homeodomain-like
NULL
coil ?[104-125] coiled-coil
seg ?[88-101]?[116-132] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like123 4e-28
TF_10_2 GARPARR-B class 98 6e-22
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 79 6e-15
TF_1_2 MYB superfamilyLHY 73 4e-13

TOP