AGI ID: At1g80390

TF ID:TF_55
Super family:Aux/IAA
Sub family:
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
>At1g80390
MSPEEYVRVW PDSGDLGGTE LTLALPGTPT NASEGPKKFG NKRRFLETVD LKLGEAHENN
YISSMVTNDQ LVGWPPVATA RKTVRRKYVK VALDGAAYLR KVDLGMYDCY GQLFTALENM
FQGIITICRV TELERKGEFV ATYEDKDGDL MLVGDVPWMM FVESCKRMRL MKTGDAIGL
Length = 179 AA.

PSI BLAST Result:

Query: Query sequence of TF_55
Sbjct: At1g80390

>At1g80390 unknown protein
          Length = 179

 Score =  186 bits (474), Expect = 6e-48
 Identities = 88/214 (41%), Positives = 107/214 (49%), Gaps = 53/214 (24%)

Query: 8   NLRETELCLGLPGGDTVAPVT----GNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFD 63
           +L  TEL L LPG  T A       GNKR F ETVDLKL   +E        T+D     
Sbjct: 15  DLGGTELTLALPGTPTNASEGPKKFGNKRRFLETVDLKLGEAHENNYISSMVTND----- 69

Query: 64  SKEXXXXXXXXXXXXXXXQVVGWPLVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYL 123
                             Q+VGWP V + RK                 +VKV++DGA YL
Sbjct: 70  ------------------QLVGWPPVATARK------------TVRRKYVKVALDGAAYL 99

Query: 124 RKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYED 183
           RK+DL MY  Y +L  AL NMF           +G+I         +L    ++V +YED
Sbjct: 100 RKVDLGMYDCYGQLFTALENMF-----------QGIITICRVT---ELERKGEFVATYED 145

Query: 184 KDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGL 217
           KDGD MLVGDVPW MFV++CKR+RLMK  DAIGL
Sbjct: 146 KDGDLMLVGDVPWMMFVESCKRMRLMKTGDAIGL 179


InterPro Results:

IPR003311 Family
PF02309 T[15-179] 2.4e-41 AUX_IAA
AUX/IAA protein

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_55 Aux/IAA186 6e-48
TF_17_2 ARFNPH4/ARF7158 1e-38
TF_17_1 ARFMONOPTEROS/ARF5149 6e-36

TOP