AGI ID: At1g79700

TF ID:TF_2_2
Super family:AP2/EREBP
Sub family:AINTEGUMENTA
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
>At1g79700
MAKVSGRSKK TIVDDEISDK TASASESASI ALTSKRKRKS PPRNAPLQRS SPYRGVTRWT
GRYEAHLWDK NSWNDTQTKK GRQGAYDEEE AAARAYDLAA LKYWGRDTLL NFPLPSYDED
VKEMEGQSKE EYIGSLRRKS SGFSRGVSKY RGVARHHHNG RWEARIGRVF GNKYLYLGTY
ATQEEAAIAY DIAAIEYRGL NAVTNFDVSR YLNPNAAADK ADSDSKPIRS PSREPESSDD
NKSPKSEEVI EPSTSPEVIP TRRSFPDDIQ TYFGCQDSGK LATEEDVIFD CFNSYINPGF
YNEFDYGP
Length = 308 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_2
Sbjct: At1g79700

>At1g79700 hypothetical protein
          Length = 308

 Score =  206 bits (525), Expect = 2e-53
 Identities = 123/294 (41%), Positives = 163/294 (54%), Gaps = 26/294 (8%)

Query: 233 SEALVETSVGFETTTMAAAKKKRGQEDVVVVGQKQIVHRKSIDTFGQRTSQYRGVTRHRW 292
            E   +T                 +   + +  K+       +   QR+S YRGVTR  W
Sbjct: 15  DEISDKT-------------ASASESASIALTSKRKRKSPPRNAPLQRSSPYRGVTR--W 59

Query: 293 TGRYEAHLWDNSFKKEGHSRKGRQVYLGGYDMEEKAARAYDLAALKYWGPSTHTNFSAEN 352
           TGRYEAHLWD +   +  ++KGRQ   G YD EE AARAYDLAALKYWG  T  NF   +
Sbjct: 60  TGRYEAHLWDKNSWNDTQTKKGRQ---GAYDEEEAAARAYDLAALKYWGRDTLLNFPLPS 116

Query: 353 YQKEIEDMKNMTRQEYVAHLRRKSSGFSRGASIYRGVTRHHQHGRWQARIGRVAGNKDLY 412
           Y +++++M+  +++EY+  LRRKSSGFSRG S YRGV RHH +GRW+ARIGRV GNK LY
Sbjct: 117 YDEDVKEMEGQSKEEYIGSLRRKSSGFSRGVSKYRGVARHHHNGRWEARIGRVFGNKYLY 176

Query: 413 LGTFGTQEEAAEAYDVAAIKFRGTNAVTNFDITRYDVDRIMSSNTLLSGELARRNNNSIV 472
           LGT+ TQEEAA AYD+AAI++RG NAVTNFD++RY      +       +  R  +    
Sbjct: 177 LGTYATQEEAAIAYDIAAIEYRGLNAVTNFDVSRYLNPNAAADKADSDSKPIRSPSREPE 236

Query: 473 VRNTEDQTALNAVVEGGSNKEVSTPERLLSFPAIFALPQVNQKMFGSNMGGNMS 526
             +         V+E  ++ EV         P   + P   Q  FG    G ++
Sbjct: 237 SSDDNKSPKSEEVIEPSTSPEV--------IPTRRSFPDDIQTYFGCQDSGKLA 282


InterPro Results:

IPR001471 Domain
PD001423 T[160-200] 0.0001 sp_Q9FIE2_ARATH_Q9FIE2;
PR00367 T[150-161] 2e-05T[189-209] 2e-05 ETHRSPELEMNT
PF00847 T[51-118] 9e-28T[148-212] 1.9e-29 AP2
SM00380 T[52-119] 1.7e-16T[149-213] 1.1e-25 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[85-101]?[184-197]?[216-226]?[229-240] seg
SSF54171 T[51-115] 6.5e-15T[148-209] 6.1e-20 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_2 AP2/EREBPAINTEGUMENTA206 2e-53
TF_2_3 AP2/EREBPAPETALA2178 7e-45
TF_2_4 AP2/EREBPCBF1106 9e-24
TF_67 Pti6 96 1e-20
TF_68 ERF 79 2e-15
TF_66 Pti5 76 1e-14
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 73 2e-13
TF_2_5 AP2/EREBPDREB2A 44 1e-04
TF_65 Pti4 41 4e-04

TOP