AGI ID: At1g79430

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
>At1g79430
MFHAKKPSSM NGSYENRAMC VQGDSGLVLT TDPKPRLRWT VELHERFVDA VAQLGGPDKA
TPKTIMRVMG VKGLTLYHLK SHLQKFRLGK QPHKEYGDHS TKEGSRASAM DIQRNVASSS
GMMSRNMNEM QMEVQRRLHE QLEVQRHLQL RIEAQGKYMQ SILERACQTL AGENMAAATA
AAAVGGGYKG NLGSSSLSAA VGPPPHPLSF PPFQDLNIYG NTTDQVLDHH NFHHQNIENH
FTGNNAADTN IYLGKKRPNP NFGNDVRKGL LMWSDQDHDL SANQSIDDEH RIQIQMATHV
STDLDSLSEI YERKSGLSGD EGNNGGKLLE RPSPRRSPLS PMMNPNGGLI QGRNSPFG
Length = 358 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At1g79430

>At1g79430 unknown protein
          Length = 358

 Score =  114 bits (285), Expect = 2e-25
 Identities = 42/61 (68%), Positives = 49/61 (79%)

Query: 183 TGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRLN 242
           T   K RLRWT ELH RFV+AV  LGGPDKATPK I+++MGV GLT+YH+KSHLQK+RL 
Sbjct: 30  TTDPKPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRLG 89

Query: 243 I 243
            
Sbjct: 90  K 90



 Score = 88.9 bits (219), Expect = 1e-17
 Identities = 25/48 (52%), Positives = 35/48 (72%), Gaps = 3/48 (6%)

Query: 383 RNLEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEGLT 430
           RN+ E    QME+Q++LHEQLE QR LQL +EA G+Y+ S++E+   T
Sbjct: 125 RNMNE---MQMEVQRRLHEQLEVQRHLQLRIEAQGKYMQSILERACQT 169


InterPro Results:

IPR001005 Domain
PF00249 T[36-87] 1.7e-11 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[34-90] 7.3e-30 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[30-94] 4.6e-18 Homeodomain-like
Homeodomain-like
NULL
seg ?[171-190]?[203-212]?[328-341] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map
Alternative splicing: Yes

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like114 2e-25
TF_10_2 GARPARR-B class 96 4e-21
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 77 2e-14
TF_1_2 MYB superfamilyLHY 72 1e-12

TOP