AGI ID: At1g78640

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: Hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
>At1g78640
MAEEQREISH ENNVSLGSAE TAIPLTNVSI SPTKKEEQKT VYLVLFGRTI YVESSSLESE
ETVMPIVDVP KSPAKEDLTT HCSLDAESSE KGFPVDPYMG ILGNNPNINS NVTCAGNKDL
TEDIIKFKKM RSLSKEKIVE EKGTRVLTEL PPYTWTIKKT LKESDINHQC RLLLNTTDAE
NHIMRHLPTD DQKKIQEGIG VDVKAYDHDT YTEHDMVFKR HVKTSKSYVF NGGWAKAFVG
RRELKEGDKI GLFWAKKSQT FMSQEQQGTS PLNTDEALKS HHSFSQNPNY IESNLSRRYQ
TNFSLGSQRI SGQFLMIPNP GFVDTSSMTN THDTSLANFQ TVPTTTNPKI ILKEEKENEE
EQQYWTIKKE LTKSDACQRL TLSKSSVEEH ILKHLLPEDS QKIDKGKPGI TVKVYDNDTD
TEHELCLAFQ CSYVLKNGWV KTFVKRRGLE EGDMIGLFWE CSTSKLHFSV LFRVNAKAPA
AEEKEAY
Length = 487 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At1g78640

>At1g78640 Hypothetical protein
          Length = 487

 Score = 98.1 bits (243), Expect = 3e-20
 Identities = 24/152 (15%), Positives = 41/152 (26%), Gaps = 9/152 (5%)

Query: 81  NVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGLKLNRQPNEFFCKTLTASDTSTHG 140
           NVT   + +  E   +         ++         L           KTL  SD +   
Sbjct: 111 NVTCAGNKDLTEDIIKFKKMRSLSKEKIVEEKGTRVLTELPPYTWTIKKTLKESDINHQC 170

Query: 141 GFSVPR----RAAEKIFPALDFS--MQPPCQELVAKDIHD-NTWTFRHIYR-GQPKRHLL 192
              +          +  P  D     +    ++ A D                  K ++ 
Sbjct: 171 RLLLNTTDAENHIMRHLPTDDQKKIQEGIGVDVKAYDHDTYTEHDMVFKRHVKTSKSYVF 230

Query: 193 TTGW-SVFVSTKRLFAGDSVLFIRDGKAQLLL 223
             GW   FV  + L  GD +      K+Q  +
Sbjct: 231 NGGWAKAFVGRRELKEGDKIGLFWAKKSQTFM 262



 Score = 69.2 bits (168), Expect = 1e-11
 Identities = 21/137 (15%), Positives = 37/137 (26%), Gaps = 16/137 (11%)

Query: 88  PETDEVYAQMTLQPVNKYDRDALLASDMGLKLNRQPNEFFCKTLTASDTSTHGGFSVPR- 146
              D   A     P    +   +L  +   +  +Q      K LT SD       ++ + 
Sbjct: 330 NTHDTSLANFQTVPTTT-NPKIILKEEKENEEEQQY-WTIKKELTKSDA--CQRLTLSKS 385

Query: 147 ---RAAEKIFPALDFSMQPPCQE---LVAKDIHDN-TWTFRHIYRGQPKRHLLTTGW-SV 198
                  K     D       +    +   D   +        +      ++L  GW   
Sbjct: 386 SVEEHILKHLLPEDSQKIDKGKPGITVKVYDNDTDTEHELCLAF---QCSYVLKNGWVKT 442

Query: 199 FVSTKRLFAGDSVLFIR 215
           FV  + L  GD +    
Sbjct: 443 FVKRRGLEEGDMIGLFW 459


InterPro Results:

IPR000170 Family
SSF57652 T[4-447] 1.1e-10 HIPIP (high potential iron protein)
High potential iron-sulfur protein
NULL
seg ?[53-61]?[353-361]?[476-486] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7 98 3e-20
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 97 3e-20
TF_22_1 ABI3/VP1FUSCA3 85 5e-17

TOP