AGI ID: At1g77850

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: putative auxin response factor protein (T32E8.16)

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
>At1g77850
MSPPSATAGD INHREVDPTI WRACAGASVQ IPVLHSRVYY FPQGHVEHCC PLLSTLPSST
SPVPCIITSI QLLADPVTDE VFAHLILQPM TQQQFTPTNY SRFGRFDGDV DDNNKVTTFA
KILTPSDANN GGGFSVPRFC ADSVFPLLNF QIDPPVQKLY VTDIHGAVWD FRHIYRGTPR
RHLLTTGWSK FVNSKKLIAG DSVVFMRKSA DEMFIGVRRT PISSSDGGSS YYGGDEYNGY
YSQSSVAKED DGSPKKTFRR SGNGKLTAEA VTDAINRASQ GLPFEVVFYP AAGWSEFVVR
AEDVESSMSM YWTPGTRVKM AMETEDSSRI TWFQGIVSST YQETGPWRGS PWKQLQITWD
EPEILQNVKR VNPWQVEIAA HATQLHTPFP PAKRLKYPQP GGGFLSGDDG EILYPQSGLS
SAAAPDPSPS MFSYSTFPAG MQGARQYDFG SFNPTGFIGG NPPQLFTNNF LSPLPDLGKV
STEMMNFGSP PSDNLSPNSN TTNLSSGNDL VGNRGPLSKK VNSIQLFGKI ITVEEHSESG
PAESGLCEED GSKESSDNET QLSLSHAPPS VPKHSNSNAG SSSQG
Length = 585 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At1g77850

>At1g77850 putative auxin response factor protein (T32E8.16)
          Length = 585

 Score =  484 bits (1246), Expect = e-136
 Identities = 148/529 (27%), Positives = 218/529 (40%), Gaps = 77/529 (14%)

Query: 10  SPNPVEGERRNINSELWHACAGPLISLPPAGSLVVYFPQGHSEQVAASMQKQTDFIPSYP 69
           S    +   R ++  +W ACAG  + +P   S V YFPQGH E            + + P
Sbjct: 5   SATAGDINHREVDPTIWRACAGASVQIPVLHSRVYYFPQGHVEHCCPL-------LSTLP 57

Query: 70  NLPSKLICMLHNVTLNADPETDEVYAQMTLQPV-------NKYDRDALLASDMGLKLNRQ 122
           +  S + C++ ++ L ADP TDEV+A + LQP+         Y R      D+       
Sbjct: 58  SSTSPVPCIITSIQLLADPVTDEVFAHLILQPMTQQQFTPTNYSRFGRFDGDVDDN---N 114

Query: 123 PNEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQPPCQELVAKDIHDNTWTFRHI 182
               F K LT SD +  GGFSVPR  A+ +FP L+F + PP Q+L   DIH   W FRHI
Sbjct: 115 KVTTFAKILTPSDANNGGGFSVPRFCADSVFPLLNFQIDPPVQKLYVTDIHGAVWDFRHI 174

Query: 183 YRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDGKAQLLLGIRRA-------------- 228
           YRG P+RHLLTTGWS FV++K+L AGDSV+F+R    ++ +G+RR               
Sbjct: 175 YRGTPRRHLLTTGWSKFVNSKKLIAGDSVVFMRKSADEMFIGVRRTPISSSDGGSSYYGG 234

Query: 229 ---------------NRQQPALXXXXXXXXXMHIGVLXXXXXXXXXXSPFTIFYNPRWAA 273
                          +   P           +    +           PF + + P  A 
Sbjct: 235 DEYNGYYSQSSVAKEDDGSPKKTFRRSGNGKLTAEAVTDAINRASQGLPFEVVFYPA-AG 293

Query: 274 PAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWR 333
            +EFVV       +M    + G R +M  ETE+     +   +   +  +   W+ S W+
Sbjct: 294 WSEFVVRAEDVESSMSMYWTPGTRVKMAMETEDSSRITWFQGIVSSTYQETGPWRGSPWK 353

Query: 334 NLQIGWDESAAGDRPSRVSVWDIE------PVLTPFYICPPPFFRPRFSGQPGMPDDETD 387
            LQI WDE        RV+ W +E       + TPF    PP  R ++    G      D
Sbjct: 354 QLQITWDEPEILQNVKRVNPWQVEIAAHATQLHTPF----PPAKRLKYPQPGGGFLSGDD 409

Query: 388 MESALKRAMPWLDNSLEMKDPSSTIFPGLSLVQWMNMQQQNGQLPS--------AAAQPG 439
            E    ++     +S    DPS ++F   S         +     S              
Sbjct: 410 GEILYPQSG---LSSAAAPDPSPSMF-SYSTFPAGMQGARQYDFGSFNPTGFIGGNPPQL 465

Query: 440 FFPSMLSPTAALHNNLGGTDDPSKLLSFQTPHGGISSSNLQFNKQNQQA 488
           F  + LSP   L +    +    ++++F +P     S N   N  N  +
Sbjct: 466 FTNNFLSP---LPDLGKVST---EMMNFGSPPSDNLSPNS--NTTNLSS 506


InterPro Results:

IPR003340 Family
PF02362 T[118-223] 6.9e-09 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[274-356] 1.6e-36 Auxin_resp
Auxin response factor
NULL
seg ?[51-62]?[223-242]?[420-430]?[488-510] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7484 e-136
TF_17_1 ARFMONOPTEROS/ARF5474 e-133
TF_17_3 ARFETTIN/ARF3431 e-121
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3110 3e-24
TF_22_1 ABI3/VP1FUSCA3106 2e-23

TOP