AGI ID: At1g77640

TF ID:TF_2_4
Super family:AP2/EREBP
Sub family:CBF1
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
>At1g77640
MVKQELKIQV TTSSSSLSHS SSSSSSSTSA LRHQSCKNKI KKYKGVRMRS WGSWVTEIRA
PNQKTRIWLG SYSTAEAAAR AYDAALLCLK GPKANLNFPN ITTTSPFLMN IDEKTLLSPK
SIQKVAAQAA NSSSDHFTPP SDENDHDHDD GLDHHPSASS SAASSPPDDD HHNDDDGDLV
SLMESFVDYN EHVSLMDPSL YEFGHNEIFF TNGDPFDYSP QLHSSEATMD DFYDDVDIPL
WSFS
Length = 244 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_4
Sbjct: At1g77640

>At1g77640 hypothetical protein
          Length = 244

 Score =  104 bits (260), Expect = 3e-23
 Identities = 43/123 (34%), Positives = 61/123 (48%), Gaps = 10/123 (8%)

Query: 8   LAEMRPKKRAGRRVFKETRHPVYRGIRRRNGDKWVCEVREPTHQRRIWLGTYPTADMAAR 67
            +       A R    + +   Y+G+R R+   WV E+R P  + RIWLG+Y TA+ AAR
Sbjct: 21  SSSSSSSTSALRHQSCKNKIKKYKGVRMRSWGSWVTEIRAPNQKTRIWLGSYSTAEAAAR 80

Query: 68  AHDVAVLALRGRSACLNFADSAWRLPVPES------NDPDVIRRVAAEAAEM----FRPV 117
           A+D A+L L+G  A LNF +     P   +        P  I++VAA+AA      F P 
Sbjct: 81  AYDAALLCLKGPKANLNFPNITTTSPFLMNIDEKTLLSPKSIQKVAAQAANSSSDHFTPP 140

Query: 118 DLE 120
             E
Sbjct: 141 SDE 143


InterPro Results:

IPR001471 Domain
PD001423 T[49-74] 5e-09 sp_Q9CAP4_ARATH_Q9CAP4;
PR00367 T[43-54] 5.2e-10T[65-81] 5.2e-10 ETHRSPELEMNT
PF00847 T[41-104] 2.2e-33 AP2
SM00380 T[42-105] 3e-34 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[11-29]?[75-85]?[142-178] seg
SSF54171 T[41-101] 1.3e-20 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_4 AP2/EREBPCBF1104 3e-23
TF_2_5 AP2/EREBPDREB2A 93 1e-19
TF_65 Pti4 91 6e-19
TF_2_3 AP2/EREBPAPETALA2 90 2e-18
TF_68 ERF 89 2e-18
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 86 3e-17
TF_66 Pti5 83 4e-17
TF_67 Pti6 85 4e-17
TF_2_2 AP2/EREBPAINTEGUMENTA 81 1e-15

TOP