AGI ID: At1g69580

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: transfactor, putative

Amino Acid Sequence:


1
61
121
181
241
301
>At1g69580
MEINNNANNT NTTIDNHKAK MSLVLSTDAK PRLKWTCDLH HKFIEAVNQL GGPNKATPKG
LMKVMEIPGL TLYHLKSHLQ KYRLGKSMKF DDNKLEVSSA SENQEVESKN DSRDLRGCSV
TEENSNPAKE GLQITEALQM QMEVQKKLHE QIEVQRHLQV KIEAQGKYLQ SVLMKAQQTL
AGYSSSNLGM DFARTELSRL ASMVNRGCPS TSFSELTQVE EEEEGFLWYK KPENRGISQL
RCSVESSLTS SETSETKLDT DNNLNKSIEL PLMEINSEVM KGKKRSINDV VCVEQPLMKR
AFGVDDDEHL KLSLNTYKKD MEACTNIGLG FN
Length = 332 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At1g69580

>At1g69580 transfactor, putative
          Length = 332

 Score =  110 bits (276), Expect = 2e-24
 Identities = 38/63 (60%), Positives = 52/63 (82%)

Query: 183 TGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRLN 242
           +  AK RL+WT +LH++F+ AVN LGGP+KATPKG++K+M + GLT+YH+KSHLQKYRL 
Sbjct: 26  STDAKPRLKWTCDLHHKFIEAVNQLGGPNKATPKGLMKVMEIPGLTLYHLKSHLQKYRLG 85

Query: 243 IRL 245
             +
Sbjct: 86  KSM 88



 Score = 92.4 bits (228), Expect = 8e-19
 Identities = 24/46 (52%), Positives = 34/46 (73%)

Query: 385 LEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEGLT 430
           + EAL  QME+QKKLHEQ+E QR LQ+ +EA G+Y+ S++ +   T
Sbjct: 134 ITEALQMQMEVQKKLHEQIEVQRHLQVKIEAQGKYLQSVLMKAQQT 179


InterPro Results:

IPR001005 Domain
PF00249 T[32-83] 1.6e-07 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[30-86] 2.3e-26 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[26-87] 5.8e-16 Homeodomain-like
Homeodomain-like
NULL
seg ?[4-13]?[243-256] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like110 2e-24
TF_10_2 GARPARR-B class 91 9e-20
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 71 2e-12
TF_1_2 MYB superfamilyLHY 59 8e-09

TOP