AGI ID: At1g68840

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: putative DNA-binding protein protein RAV2

Amino Acid Sequence:


1
61
121
181
241
301
>At1g68840
MDSSCIDEIS SSTSESFSAT TAKKLSPPPA AALRLYRMGS GGSSVVLDPE NGLETESRKL
PSSKYKGVVP QPNGRWGAQI YEKHQRVWLG TFNEQEEAAR SYDIAACRFR GRDAVVNFKN
VLEDGDLAFL EAHSKAEIVD MLRKHTYADE LEQNNKRQLF LSVDANGKRN GSSTTQNDKV
LKTREVLFEK AVTPSDVGKL NRLVIPKQHA EKHFPLPSPS PAVTKGVLIN FEDVNGKVWR
FRYSYWNSSQ SYVLTKGWSR FVKEKNLRAG DVVTFERSTG LERQLYIDWK VRSGPRENPV
QVVVRLFGVD IFNVTTVKPN DVVAVCGGKR SRDVDDMFAL RCSKKQAIIN AL
Length = 352 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At1g68840

>At1g68840 putative DNA-binding protein protein RAV2
          Length = 352

 Score =  175 bits (443), Expect = 9e-44
 Identities = 39/160 (24%), Positives = 66/160 (40%), Gaps = 12/160 (7%)

Query: 138 IDVDGGEEDYEVLKR----SNTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYS-Q 192
           +D +G        +          +F K +T SD        +P++ AE  FP    S  
Sbjct: 163 VDANGKRNGSSTTQNDKVLKTREVLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLPSPSPA 222

Query: 193 PRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGD--D 250
                 +   D++G  WRFR+ Y    + ++LT GWS FV +K L +GD V F R    +
Sbjct: 223 VTKGVLINFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVTFERSTGLE 282

Query: 251 GKLRLGVR-----RASQIEGTAALSAQYNQNMNHNNFSEV 285
            +L +  +     R + ++    L      N+     ++V
Sbjct: 283 RQLYIDWKVRSGPRENPVQVVVRLFGVDIFNVTTVKPNDV 322


InterPro Results:

IPR001471 Domain
PD001423 T[74-111] 2e-16 sp_Q8LDM7_ARATH_Q8LDM7;
PR00367 T[65-76] 1.2e-05T[85-101] 1.2e-05 ETHRSPELEMNT
PF00847 T[63-124] 1.6e-35 AP2
SM00380 T[64-125] 6.2e-32 AP2
Pathogenesis-related transcriptional factor and ERF
IPR003340 Family
PF02362 T[187-295] 1.2e-28 B3
Transcriptional factor B3
IPR008994 Domain
SSF50249 T[221-301] 7.4e-07 Nucleic acid-binding proteins
Nucleic acid-binding OB-fold
NULL
seg ?[2-33] seg
SSF54171 T[63-122] 4e-18 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3175 9e-44
TF_17_2 ARFNPH4/ARF7175 2e-43
TF_17_1 ARFMONOPTEROS/ARF5165 8e-41
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3128 1e-29
TF_22_1 ABI3/VP1FUSCA3118 4e-27
TF_2_2 AP2/EREBPAINTEGUMENTA112 7e-25
TF_68 ERF 97 6e-21
TF_67 Pti6 97 8e-21
TF_2_3 AP2/EREBPAPETALA2 97 1e-20
TF_2_4 AP2/EREBPCBF1 96 1e-20
TF_66 Pti5 85 2e-17
TF_65 Pti4 78 5e-15
TF_2_5 AP2/EREBPDREB2A 78 1e-14
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 75 4e-14

TOP