AGI ID: At1g68670

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
>At1g68670
MMVEMDYAKK MQKCHEYVEA LEEEQKKIQV FQRELPLCLE LVTQAIEACR KELSGTTTTT
SEQCSEQTTS VCGGPVFEEF IPIKKISSLC EEVQEEEEED GEHESSPELV NNKKSDWLRS
VQLWNHSPDL NPKEERVAKK AKVVEVKPKS GAFQPFQKRV LETDLQPAVK VASSMPATTT
SSTTETCGGK SDLIKAGDEE RRIEQQQSQS HTHRKQRRCW SPELHRRFLN ALQQLGGSHV
ATPKQIRDHM KVDGLTNDEV KSHLQKYRLH TRRPAATSVA AQSTGNQQQP QFVVVGGIWV
PSSQDFPPPS DVANKGGVYA PVAVAQSPKR SLERSCNSPA ASSSTNTNTS TPVS
Length = 354 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At1g68670

>At1g68670 unknown protein
          Length = 354

 Score =  124 bits (311), Expect = 2e-28
 Identities = 38/70 (54%), Positives = 44/70 (62%)

Query: 177 QPQRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHL 236
           Q Q  +    K R  W+PELH RF+NA+  LGG   ATPK I   M VDGLT   +KSHL
Sbjct: 205 QQQSQSHTHRKQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHL 264

Query: 237 QKYRLNIRLP 246
           QKYRL+ R P
Sbjct: 265 QKYRLHTRRP 274


InterPro Results:

IPR001005 Domain
PF00249 T[217-268] 1.1e-11 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[215-271] 5.1e-36 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[211-275] 3.5e-19 Homeodomain-like
Homeodomain-like
NULL
coil ?[14-35] coiled-coil
seg ?[56-70]?[87-108]?[132-149]?[178-186]?[205-210]?[337-352] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like124 2e-28
TF_10_2 GARPARR-B class102 5e-23
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 78 1e-14
TF_1_2 MYB superfamilyLHY 72 9e-13

TOP