AGI ID: At1g67710

TF ID:TF_1_2
Super family:MYB superfamily
Sub family:LHY
Gene name: response regulator 11 (ARR11)

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
>At1g67710
MEKSGFSPVG LRVLVVDDDP TWLKILEKML KKCSYEVTTC GLAREALRLL RERKDGYDIV
ISDVNMPDMD GFKLLEHVGL ELDLPVIMMS VDGETSRVMK GVQHGACDYL LKPIRMKELK
IIWQHVLRKK LQEVRDIEGC GYEGGADWIT RYDEAHFLGG GEDVSFGKKR KDFDFEKKLL
QDESDPSSSS SKKARVVWSF ELHHKFVNAV NQIGCDHKAG PKKILDLMNV PWLTRENVAS
HLQKYRLYLS RLEKGKELKC YSGGVKNADS SPKDVEVNSG YQSPGRSSYV FSGGNSLIQK
ATEIDPKPLA SASLSDLNTD VIMPPKTKKT RIGFDPPISS SAFDSLLPWN DVPEVLESKP
VLYENSFLQQ QPLPSQSSYV ANSAPSLMEE EMKPPYETPA GGSSVNADEF LMPQDKIPTV
TLQDLDPSAM KLQEFNTEAI LRSLNWELPE SHHSVSLDTD LDLTWLQGER FLANTGLQFQ
DYSSSPSLLS ELPAHLNWYG NERLPDPDEY SFMVDQGLFI S
Length = 521 AA.

PSI BLAST Result:

Query: Query sequence of TF_1_2
Sbjct: At1g67710

>At1g67710 response regulator 11 (ARR11)
          Length = 521

 Score =  110 bits (275), Expect = 3e-24
 Identities = 31/144 (21%), Positives = 55/144 (37%), Gaps = 17/144 (11%)

Query: 19  TITKQRERWTEDEHERFLEALRLYG----RAWQRIEEH--IGTKTAVQIRSHAQKFFTKL 72
           +  K R  W+ + H +F+ A+   G       ++I +   +   T   + SH QK+   L
Sbjct: 190 SSKKARVVWSFELHHKFVNAVNQIGCDHKAGPKKILDLMNVPWLTRENVASHLQKYRLYL 249

Query: 73  EKEAEVKGIPVCQALDIEIXXXXXXXXXXXXXXXXXG------NNGTSSSQVSSAKDAKL 126
            +  + K +  C +  ++                  G      + G S  Q ++  D K 
Sbjct: 250 SRLEKGKELK-CYSGGVKNADSSPKDVEVNSGYQSPGRSSYVFSGGNSLIQKATEIDPKP 308

Query: 127 VSSASSSQLNQAFLDLEKMPFSEK 150
           ++SAS S LN   +    MP   K
Sbjct: 309 LASASLSDLNTDVI----MPPKTK 328


InterPro Results:

IPR001005 Domain
PF00249 T[195-246] 9.8e-10 Myb_DNA-binding
Myb, DNA-binding
IPR001789 Domain
PD000039 T[12-119] 5e-49 sp_Q9MAY2_ARATH_Q9MAY2;
PF00072 T[11-131] 1.7e-26 Response_reg
SM00448 T[11-123] 5.6e-32 REC
PS50110 T[12-127] 33.398 RESPONSE_REGULATORY
Response regulator receiver
IPR006447 Domain
TIGR01557 T[193-249] 2.9e-27 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[189-253] 1.9e-18 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[10-144] 1.3e-32 CheY-like
CheY-like
NULL
seg ?[42-53]?[187-193]?[366-378]?[483-493] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_1_2 MYB superfamilyLHY110 3e-24
TF_10_1 GARPG2-like108 8e-24
TF_10_2 GARPARR-B class101 9e-23
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 86 6e-17

TOP