AGI ID: At1g63030

TF ID:TF_2_4
Super family:AP2/EREBP
Sub family:CBF1
Gene name: transcription factor DREB1A, putative

Amino Acid Sequence:


1
61
121
181
>At1g63030
MENDDITVAE MKPKKRAGRR IFKETRHPIY RGVRRRDGDK WVCEVREPIH QRRVWLGTYP
TADMAARAHD VAVLALRGRS ACLNFSDSAW RLPVPASTDP DTIRRTAAEA AEMFRPPEFS
TGITVLPSAS EFDTSDEGVA GMMMRLAEEP LMSPPRSYID MNTSVYVDEE MCYEDLSLWS
Y
Length = 181 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_4
Sbjct: At1g63030

>At1g63030 transcription factor DREB1A, putative
          Length = 181

 Score =  209 bits (533), Expect = 8e-55
 Identities = 141/208 (67%), Positives = 158/208 (75%), Gaps = 28/208 (13%)

Query: 1   MNNDDIILAEMRPKKRAGRRVFKETRHPVYRGIRRRNGDKWVCEVREPTHQRRIWLGTYP 60
           M NDDI +AEM+PKKRAGRR+FKETRHP+YRG+RRR+GDKWVCEVREP HQRR+WLGTYP
Sbjct: 1   MENDDITVAEMKPKKRAGRRIFKETRHPIYRGVRRRDGDKWVCEVREPIHQRRVWLGTYP 60

Query: 61  TADMAARAHDVAVLALRGRSACLNFADSAWRLPVPESNDPDVIRRVAAEAAEMFRPVDLE 120
           TADMAARAHDVAVLALRGRSACLNF+DSAWRLPVP S DPD IRR AAEAAEMFRP +  
Sbjct: 61  TADMAARAHDVAVLALRGRSACLNFSDSAWRLPVPASTDPDTIRRTAAEAAEMFRPPEFS 120

Query: 121 SGITVLPCAGDDVDLXXXXXXXXXXXXXXXXXXXXXFGDYEE-VSTTMMRLAEGPLMSPP 179
           +GITVLP A +                         F   +E V+  MMRLAE PLMSPP
Sbjct: 121 TGITVLPSASE-------------------------FDTSDEGVAGMMMRLAEEPLMSPP 155

Query: 180 RSYMEDMTPTNVYTEEEMCYEDMSLWSY 207
           RSY+     T+VY +EEMCYED+SLWSY
Sbjct: 156 RSYI--DMNTSVYVDEEMCYEDLSLWSY 181


InterPro Results:

IPR001471 Domain
PD001423 T[40-78] 6e-17 sp_Q9SGJ6_ARATH_Q9SGJ6;
PR00367 T[30-41] 2.1e-08T[52-68] 2.1e-08 ETHRSPELEMNT
PF00847 T[28-91] 3.1e-31 AP2
SM00380 T[29-92] 4.5e-24 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
SSF54171 T[28-88] 6e-22 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_4 AP2/EREBPCBF1209 8e-55
TF_2_2 AP2/EREBPAINTEGUMENTA148 1e-35
TF_2_3 AP2/EREBPAPETALA2121 8e-28
TF_67 Pti6113 1e-25
TF_68 ERF108 2e-24
TF_2_5 AP2/EREBPDREB2A 92 4e-19
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 90 2e-18
TF_65 Pti4 89 2e-18
TF_66 Pti5 83 6e-17

TOP