AGI ID: At1g59750

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
>At1g59750
MAASNHSSGK PGGVLSDALC RELWHACAGP LVTLPREGER VYYFPEGHME QLEASMHQGL
EQQMPSFNLP SKILCKVINI QRRAEPETDE VYAQITLLPE LDQSEPTSPD APVQEPEKCT
VHSFCKTLTA SDTSTHGGFS VLRRHADDCL PPLDMSQQPP WQELVATDLH NSEWHFRHIF
RGQPRRHLLT TGWSVFVSSK KLVAGDAFIF LRGENEELRV GVRRHMRQQT NIPSSVISSH
SMHIGVLATA AHAITTGTIF SVFYKPRTSR SEFIVSVNRY LEAKTQKLSV GMRFKMRFEG
EEAPEKRFSG TIVGVQENKS SVWHDSEWRS LKVQWDEPSS VFRPERVSPW ELEPLVANST
PSSQPQPPQR NKRPRPPGLP SPATGPSGPV TPDGVWKSPA DTPSSVPLFS PPAKAATFGH
GGNKSFGVSI GSAFWPTNAD SAAESFASAF NNESTEKKQT NGNVCRLFGF ELVENVNVDE
CFSAASVSGA VAVDQPVPSN EFDSGQQSEP LNINQSDIPS GSGDPEKSSL RSPQESQSRQ
IRSCTKVHMQ GSAVGRAIDL TRSECYEDLF KKLEEMFDIK GELLESTKKW QVVYTDDEDD
MMMVGDDPWN EFCGMVRKIF IYTPEEVKKL SPKNKLAVNA RMQLKADAEE NGNTEGRSSS
MAGSR
Length = 665 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At1g59750

>At1g59750 putative protein
          Length = 665

 Score =  599 bits (1546), Expect = e-171
 Identities = 198/549 (36%), Positives = 282/549 (51%), Gaps = 46/549 (8%)

Query: 39  LLKDQSGTRKPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPN 98
                 G     +  ELWHACAGPLV LP+ G  VYYF +GH EQ+  S  +    Q+P+
Sbjct: 7   SSGKPGGVLSDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEASMHQGLEQQMPS 66

Query: 99  YPNLPSQLMCQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFF 158
           + NLPS+++C+V N+   A+ ++DE+YAQ++L P   + +    PD  +    K     F
Sbjct: 67  F-NLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTS-PDAPVQEPEKCTVHSF 124

Query: 159 CKTLTASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQP 218
           CKTLTASDTSTHGGFSV RR A+   PPLD S QPP QELV  DLH + W FRHI+RGQP
Sbjct: 125 CKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQP 184

Query: 219 KRHLLTTGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHI 278
           +RHLLTTGWS+FV SK+L AGD+ +F+R E  +L VGVRR  RQQT +PSSV+S+ SMHI
Sbjct: 185 RRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRQQTNIPSSVISSHSMHI 244

Query: 279 GVLXXXXXXXXNRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDS 338
           GVL          T F +FY PR   +EF++ + +Y +A    +LSVGMRF M FE E++
Sbjct: 245 GVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEA-KTQKLSVGMRFKMRFEGEEA 303

Query: 339 GKRRYMGTIVGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPE---SLFI 395
            ++R+ GTIVG+ +     W  S+WR+L+V+WDEP    +P RVSPW++E      +   
Sbjct: 304 PEKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSS 363

Query: 396 FPSLTSGLKRQLHPSYFAGETEWGSLIKRPLIRVPDSANGIMPYASFP------------ 443
            P      KR   P   +  T     +    +    +          P            
Sbjct: 364 QPQPPQRNKRPRPPGLPSPATGPSGPVTPDGVWKSPADTPSSVPLFSPPAKAATFGHGGN 423

Query: 444 -----SMASEQL-----------------MKMMMRPHNNQNVPSFMSEMQQNIVM----G 477
                S+ S                         +  N      F  E+ +N+ +     
Sbjct: 424 KSFGVSIGSAFWPTNADSAAESFASAFNNESTEKKQTNGNVCRLFGFELVENVNVDECFS 483

Query: 478 NGGLLGDMKMQQPLMMNQKSEMVQPQNKLTVNPSASNTSGQEQNLSQSMSAPAKPENSTL 537
              + G + + QP+  N+     Q +          + SG  +    S+ +P + ++  +
Sbjct: 484 AASVSGAVAVDQPVPSNEFDSGQQSEPLNINQSDIPSGSGDPEK--SSLRSPQESQSRQI 541

Query: 538 SGCSSGRVQ 546
             C+   +Q
Sbjct: 542 RSCTKVHMQ 550



 Score =  175 bits (444), Expect = 9e-44
 Identities = 58/166 (34%), Positives = 85/166 (50%), Gaps = 12/166 (7%)

Query: 727 NTSFAQDVQSQITSASFADSQAFSRQDFPDNXXXXXXXXXNVDFDDCSLRQNSKGSSWQK 786
           + S A  V   + S  F   Q    Q  P N         + D +  SLR   +  S Q 
Sbjct: 486 SVSGAVAVDQPVPSNEFDSGQ----QSEPLNINQSDIPSGSGDPEKSSLRSPQESQSRQ- 540

Query: 787 IATPRVRTYTKVQKTG-SVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVY 845
                +R+ TKV   G +VGR+ID+T  + YE+L   +E MF ++G L       W++VY
Sbjct: 541 -----IRSCTKVHMQGSAVGRAIDLTRSECYEDLFKKLEEMFDIKGELLESTKK-WQVVY 594

Query: 846 VDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNS 891
            D E D+++VGDDPW EF G VR I I +P EV+++S +    +N+
Sbjct: 595 TDDEDDMMMVGDDPWNEFCGMVRKIFIYTPEEVKKLSPKNKLAVNA 640


InterPro Results:

IPR003340 Family
PF02362 T[123-228] 3.1e-09 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[250-332] 1e-54 Auxin_resp
Auxin response factor
NULL
seg ?[248-259]?[359-377]?[441-454]?[483-493]?[596-607] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map
Alternative splicing: Yes

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5599 e-171
TF_17_3 ARFETTIN/ARF3535 e-152
TF_17_2 ARFNPH4/ARF7513 e-145
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3152 6e-37
TF_55 Aux/IAA136 8e-33
TF_22_1 ABI3/VP1FUSCA3115 3e-26

TOP