AGI ID: At1g52830

TF ID:TF_55
Super family:Aux/IAA
Sub family:
Gene name: putative IAA6 protein

Amino Acid Sequence:


1
61
121
181
>At1g52830
MAKEGLALEI TELRLGLPGD NYSEISVCGS SKKKKRVLSD MMTSSALDTE NENSVVSSVE
DESLPVVKSQ AVGWPPVCSY RRKKNNEEAS KAIGYVKVSM DGVPYMRKID LGSSNSYINL
VTVLENLFGC LGIGVAKEGK KCEYIIIYED KDRDWMLVGD VPWQMFKESC KRLRIVKRSD
ATGFGLQQD
Length = 189 AA.

PSI BLAST Result:

Query: Query sequence of TF_55
Sbjct: At1g52830

>At1g52830 putative IAA6 protein
          Length = 189

 Score =  201 bits (511), Expect = 3e-52
 Identities = 78/221 (35%), Positives = 99/221 (44%), Gaps = 40/221 (18%)

Query: 2   MGSVELNLRETELCLGLPGGD----TVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTH 57
           M    L L  TEL LGLPG +    +V   +  K+     +     L+ E  N   S+  
Sbjct: 1   MAKEGLALEITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVE 60

Query: 58  DVVTFDSKEXXXXXXXXXXXXXXXQVVGWPLVRSYRKNVMVSCQKSSGGPEAAAFVKVSM 117
           D      K                Q VGWP V SYR+      + +    +A  +VKVSM
Sbjct: 61  DESLPVVKS---------------QAVGWPPVCSYRRK-----KNNEEASKAIGYVKVSM 100

Query: 118 DGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDY 177
           DG PY+RKIDL    SY  L   L N+F    +G                        +Y
Sbjct: 101 DGVPYMRKIDLGSSNSYINLVTVLENLFGCLGIGVAKEG----------------KKCEY 144

Query: 178 VPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLA 218
           +  YEDKD DWMLVGDVPW MF ++CKRLR++K SDA G  
Sbjct: 145 IIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATGFG 185


InterPro Results:

IPR003311 Family
PF02309 T[6-188] 3.5e-112 AUX_IAA
AUX/IAA protein
NULL
seg ?[50-67] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_55 Aux/IAA201 3e-52
TF_17_2 ARFNPH4/ARF7191 2e-48
TF_17_1 ARFMONOPTEROS/ARF5155 1e-37

TOP