AGI ID: At1g51970

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
781
>At1g51970
MAQELDLELG LAPYDPWVLK KNLTESDLNN GFIILPKQDF EKIIRQMERG LVKNLGNGVE
VKVHIIEEGP ESDDYTLTLV KCRGNCMFRG GWYNMVKAKC YKPDDEIGLM WDKCFNSTEE
RTRILLRRKM KLLRRRFFNS VNTITRPNRR HYATKYVAKV TSSSPSGRSL SAEVSLPNPL
PADVRGYPLP RRHLICRATN LITGASNLSD AFSDLSDYLS SLSLSLTPDE ASEILKSLNS
PLLAVEFFKL VPSLCPYSQN DPFLYNRIIL ILSRSNLPDR FDRVRSILDS MVKSNVHGNI
STVNILIGFF GNTEDLQMCL RLVKKWDLKM NSFTYKCLLQ AYLRSRDYSK AFDVYCEIRR
GGHKLDIFAY NMLLDALAKD EKIDQACQVF EDMKKRHCRR DEYTYTIMIR TMGRIGKCDE
AVGLFNEMIT EGLTLNVVGY NTLMQVLAKG KMVDKAIQVF SRMVETGCRP NEYTYSLLLN
LLVAEGQLVR LDGVVEISKR YMTQGIYSYL VRTLSKLGHV SEAHRLFCDM WSFPVKGERD
SYMSMLESLC GAGKTIEAIE MLSKIHEKGV VTDTMMYNTV FSALGKLKQI SHIHDLFEKM
KKDGPSPDIF TYNILIASFG RVGEVDEAIN IFEELERSDC KPDIISYNSL INCLGKNGDV
DEAHVRFKEM QEKGLNPDVV TYSTLMECFG KTERVEMAYS LFEEMLVKGC QPNIVTYNIL
LDCLEKNGRT AEAVDLYSKM KQQGLTPDSI TYTVLERLQS VSHGKSRIRR KNPITGWVVS
PL
Length = 782 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At1g51970

>At1g51970 hypothetical protein
          Length = 782

 Score = 76.8 bits (188), Expect = 1e-14
 Identities = 18/104 (17%), Positives = 38/104 (36%), Gaps = 13/104 (12%)

Query: 87  LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALE------CKEGIPIRMEDLDGF---H 137
             ++ +K L  SD+++   +ILPK+  E  +  +E         G+ +++  ++      
Sbjct: 15  DPWVLKKNLTESDLNN-GFIILPKQDFEKIIRQMERGLVKNLGNGVEVKVHIIEEGPESD 73

Query: 138 VWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLY 181
            +T        N           + V A   +  D I +  D  
Sbjct: 74  DYTLTLVKCRGN---CMFRGGWYNMVKAKCYKPDDEIGLMWDKC 114


InterPro Results:

IPR002885 Repeat
PF01535 T[333-367] 1.2e-06T[368-402] 1.6e-07T[403-437] 2.7e-09T[438-472] 5e-09T[505-539] 0.79T[540-574] 5.6e-05T[575-609] 5.7e-06T[610-644] 6.5e-11T[645-679] 9.8e-12T[680-714] 5.4e-11T[715-749] 7.1e-11 PPR
TIGR00756 T[333-367] 2.4e-06T[368-402] 2.4e-08T[403-437] 9.7e-11T[438-472] 1.6e-10T[505-539] 0.072T[540-574] 1.2e-05T[575-609] 3.6e-07T[610-644] 3.6e-13T[645-679] 1.3e-13T[680-714] 1.6e-12T[715-749] 1.1e-11 PPR
PPR repeat
IPR008941 Domain
SSF48452 T[281-488] 1.8e-28T[491-758] 1.2e-39 TPR-like
TPR-like
NULL
seg ?[121-136]?[208-226] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3 77 1e-14
TF_17_2 ARFNPH4/ARF7 76 2e-13
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 65 2e-10

TOP